HNRNPM rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HNRNPM |
HNRNPM rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HNRNPM |
Rabbit Polyclonal Anti-HNRPM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNRPM antibody: synthetic peptide directed towards the N terminal of human HNRPM. Synthetic peptide located within the following region: ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE |
Rabbit Polyclonal Anti-hnRNP M Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-hnRNP M Antibody: A synthesized peptide derived from human hnRNP M |
Rabbit Polyclonal Anti-hnRNP M Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-hnRNP M Antibody: A synthesized peptide derived from human hnRNP M |
Rabbit Polyclonal Anti-HNRNPM Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HNRNPM |
HNRNPM Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 491-730 of human HNRNPM (NP_005959.2). |
Modifications | Unmodified |
hnRNP M Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CPAQNEKRKEKNIKR |