Rabbit polyclonal antibody to UFD1L (ubiquitin fusion degradation 1 like (yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 307 of UFD1L (Uniprot ID#Q92890) |
Rabbit Polyclonal Anti-UFD1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UFD1L antibody: synthetic peptide directed towards the middle region of human UFD1L. Synthetic peptide located within the following region: NYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERQVQHEEST |
Germany
Japan
United Kingdom
China
