Products

View as table Download

Rabbit Polyclonal Anti-Cpa2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cpa2 antibody is: synthetic peptide directed towards the middle region of Rat Cpa2. Synthetic peptide located within the following region: GPGASSSPCSDSYHGPKPNSEVEVKSIVDFIKSHGKVKAFITLHSYSQLL

Rabbit polyclonal anti-Carboxypeptidase A2 (CPA2) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues surrounding amino acids 194 of mouse Carboxypeptidase A2

Rabbit Polyclonal Anti-CPA2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPA2

CPA2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPA2

CPA2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 115-419 of human CPA2 (NP_001860.2).
Modifications Unmodified