Products

View as table Download

Rabbit Polyclonal Anti-AHCYL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE

Rabbit Polyclonal Anti-AHCYL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE

AHCYL1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human AHCYL1

AHCYL1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human AHCYL1

AHCYL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 31-260 of human AHCYL1 (NP_006612.2).
Modifications Unmodified