Products

Jump to Filters
View as table Download
SIGLEC9 Rabbit Polyclonal Antibody
TA308435

USD 415.00

5 Days

Rabbit polyclonal antibody to SIGLEC9 (sialic acid binding Ig-like lectin 9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 273 of SIGLEC9 (Uniprot ID#Q9Y336)
SIGLEC9 Rabbit Polyclonal Antibody
TA341937

USD 375.00

5 Days

Rabbit Polyclonal Anti-SIGLEC9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIGLEC9 antibody: synthetic peptide directed towards the C terminal of human SIGLEC9. Synthetic peptide located within the following region: PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA
SIGLEC9 Rabbit Polyclonal Antibody
TA349776

USD 345.00

In Stock

Rabbit Polyclonal Anti-SIGLEC9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SIGLEC9
SIGLEC9 Rabbit Polyclonal Antibody
TA364716

USD 380.00

4 Weeks

SIGLEC9 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SIGLEC9
SIGLEC9 Rabbit Polyclonal Antibody
TA381494

USD 220.00

3 Weeks

SIGLEC9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 210-340 of human SIGLEC9 (NP_001185487.1).
Modifications Unmodified