Products

View as table Download

Rabbit Polyclonal Anti-E2F5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F5 antibody: synthetic peptide directed towards the N terminal of human E2F5. Synthetic peptide located within the following region: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN

Rabbit anti E2F-5 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

E2F5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 197-346 of human E2F5 (NP_001942.2).
Modifications Unmodified