Products

View as table Download

Anti-Human FGF-acidic Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human FGF-acidic

Rabbit Polyclonal Anti-Fgf1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Fgf1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTR

FGF1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human FGF1

Biotinylated Anti-Human FGF-acidic Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human FGF-acidic

Rabbit Polyclonal Anti-Fgf1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Fgf1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ

Anti-FGF1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Fibroblast growth factor 1

Anti-FGF1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Fibroblast growth factor 1

FGF1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 16-155 of human FGF1 (NP_001138364.1).
Modifications Unmodified

FGF1 Rabbit monoclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated