Products

View as table Download

Rabbit Polyclonal Anti-NPTN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN

Rabbit polyclonal anti-NPTN antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NPTN.

Rabbit Polyclonal Anti-NPTN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: SAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRK

NPTN Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-200 of human NPTN (NP_059429.1).
Modifications Unmodified