Products

Jump to Filters
View as table Download
Transketolase (TKT) Rabbit Monoclonal Antibody [Clone ID: OTIR4F5]
TA591022

USD 428.00

In Stock

Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Transketolase (TKT) Rabbit Polyclonal Antibody
TA346697

USD 475.00

5 Days

Rabbit Polyclonal Anti-TKT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TKT antibody: synthetic peptide directed towards the N terminal of human TKT. Synthetic peptide located within the following region: ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL
Transketolase (TKT) Rabbit Polyclonal Antibody
TA350534

USD 345.00

In Stock

Rabbit Polyclonal Anti-TKT Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TKT
TKT Rabbit Polyclonal Antibody
TA369419

USD 380.00

4 Weeks

TKT rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TKT
Transketolase (TKT) Rabbit Polyclonal Antibody
TA382557

USD 220.00

3 Weeks

TKT Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human TKT (NP_001128527.1).
Modifications Unmodified