Rabbit Polyclonal Anti-IL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS |
Mouse Monoclonal Anti-IL-4 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti IL-4 Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
IL4 MS Standard C13 and N15-labeled recombinant protein (NP_000580)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of IL4 (NM_000589) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human interleukin 4 (IL4), transcript variant 1
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human interleukin 4 (IL4), transcript variant 1
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human interleukin 4 (IL4), transcript variant 1
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human interleukin 4 (IL4), transcript variant 1
| Tag | tag free |
| Expression Host | E. coli |
Transient overexpression of IL4 (NM_000589) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IL4 (NM_000589) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of IL4 (NM_172348) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Germany
Japan
United Kingdom
China
