Germany
Japan
United Kingdom
China
Nt5c1b (Myc-DDK-tagged ORF) - Rat 5'-nucleotidase, cytosolic IB (Nt5c1b), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF clone of Nt5c1b (Myc-DDK-tagged ORF) - Rat 5'-nucleotidase, cytosolic IB (Nt5c1b), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nt5c1b (Myc-DDK-tagged ORF) - Rat 5'-nucleotidase, cytosolic IB (Nt5c1b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Nt5c1b (mGFP-tagged ORF) - Rat 5'-nucleotidase, cytosolic IB (Nt5c1b), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nt5c1b (GFP-tagged ORF) - Rat 5'-nucleotidase, cytosolic IB (Nt5c1b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NT5C1B (untagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-NT5C1B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5C1B antibody: synthetic peptide directed towards the N terminal of human NT5C1B. Synthetic peptide located within the following region: MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT |
Transient overexpression lysate of 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
NT5C1B (NT5C1B-RDH14) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 10-40aa) of human NT5C1B. |
Transient overexpression lysate of 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
NT5C1B CRISPRa kit - CRISPR gene activation of human 5'-nucleotidase, cytosolic IB
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Nt5c1b CRISPRa kit - CRISPR gene activation of mouse 5'-nucleotidase, cytosolic IB
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene NT5C1B
NT5C1B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NT5C1B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
NT5C1B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Nt5c1b (untagged) - Mouse 5'-nucleotidase, cytosolic IB (cDNA clone MGC:74070 IMAGE:6773248), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Nt5c1b (untagged) - Mouse 5'-nucleotidase, cytosolic IB (Nt5c1b), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Nt5c1b
Nt5c1b (untagged ORF) - Rat 5'-nucleotidase, cytosolic IB (Nt5c1b), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
NT5C1B (untagged)-Human 5'-nucleotidase, cytosolic IB (NT5C1B), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
NT5C1B (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Nt5c1b (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Nt5c1b (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of NT5C1B (NM_001002006) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NT5C1B (NM_033253) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NT5C1B (NM_001199086) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NT5C1B (NM_001199088) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NT5C1B (NM_001199087) in HEK293T cells paraffin embedded controls for ICC/IHC staining
NT5C1B - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
NT5C1B - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Nt5c1b - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Nt5c1b - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Nt5c1b - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Nt5c1b - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
NT5C1B - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Nt5c1b - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Nt5c1b - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of NT5C1B (NM_001002006) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NT5C1B (NM_001002006) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NT5C1B (NM_033253) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NT5C1B (NM_033253) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NT5C1B (NM_001199086) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NT5C1B (NM_001199086) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NT5C1B (NM_001199088) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NT5C1B (NM_001199088) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NT5C1B (NM_001199087) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NT5C1B (NM_001199087) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- NT5C1B