TGFBR2 (Myc-DDK-tagged)-Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TGFBR2 (Myc-DDK-tagged)-Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,152.00
3 Weeks
Lenti ORF particles, TGFBR2 (Myc-DDK tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 1,152.00
3 Weeks
Lenti ORF particles, TGFBR2 (mGFP-tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 1,152.00
6 Weeks
Lenti ORF particles, TGFBR2 (Myc-DDK tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,152.00
3 Weeks
Lenti ORF particles, TGFBR2 (mGFP-tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Recombinant protein of human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
TGFBR2 (Myc-DDK-tagged)-Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 950.00
2 Weeks
Lenti ORF particles, TGFBR2 (Myc-DDK tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 950.00
3 Weeks
Lenti ORF particles, TGFBR2 (mGFP-tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
TGFBR2 (GFP-tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TGFBR2 (GFP-tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TGFBR2 (untagged)-Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
TGFBR2 (untagged)-Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit Polyclonal Anti-TGFR2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2 |
Lenti ORF clone of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 1,176.00
3 Weeks
Lenti ORF particles, TGFBR2 (mGFP-tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit polyclonal TGFBR2 Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit anti-TGFBR2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TGFBR2 |
USD 1,176.00
6 Weeks
Lenti ORF particles, TGFBR2 (Myc-DDK tagged) - Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
TGFBR2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
TGFBR2 (untagged)-Kinase deficient mutant (K277M) of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal TGF beta Receptor II (Ser225/250) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TGF β Receptor II around the phosphorylation site of serine 225/250 (D-R-SP-D-I). |
Modifications | Phospho-specific |
TGF beta Receptor II (TGFBR2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Rabbit polyclonal TGF beta Receptor II antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β Receptor II antibody. |
Rabbit polyclonal anti-TGF-beta Receptor II antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 555 of rat TGF-β Receptor II. |
Rabbit Polyclonal Anti-TGFBR2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TGFBR2 Antibody: synthetic peptide directed towards the N terminal of human TGFBR2. Synthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT |
Rabbit anti TGF beta Receptor II Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the internal sequence of human TGFbR2 |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TGFBR2 mouse monoclonal antibody,clone OTI3B4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TGFBR2 mouse monoclonal antibody, clone OTI4F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TGFBR2 MS Standard C13 and N15-labeled recombinant protein (NP_003233)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
USD 379.00
In Stock
TGFBR2 mouse monoclonal antibody,clone OTI3B4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TGFBR2 mouse monoclonal antibody,clone OTI3B4, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
TGFBR2 mouse monoclonal antibody,clone OTI3B4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
TGFBR2 mouse monoclonal antibody,clone OTI3B4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
TGFBR2 mouse monoclonal antibody,clone OTI4F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TGFBR2 mouse monoclonal antibody,clone OTI4F3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
TGFBR2 mouse monoclonal antibody,clone OTI4F3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
TGFBR2 mouse monoclonal antibody,clone OTI4F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of TGFBR2 (NM_001024847) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2
Tag | C-Fc |
Expression Host | HEK293 |
Purified recombinant protein of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2
Tag | C-Fc |
Expression Host | HEK293 |
Purified recombinant protein of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2
Tag | C-Fc |
Expression Host | HEK293 |
Purified recombinant protein of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2
Tag | C-Fc |
Expression Host | HEK293 |
Transient overexpression of TGFBR2 (NM_003242) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack