Products

cDNA Clones (11)
Proteins (8)
Antibodies (3)
Jump to Filters
View as table Download
ATP5PB (NM_001688) Human Tagged ORF Clone
RC205088

USD 98.00

USD 390.00

In Stock

ATP5F1 (Myc-DDK-tagged)-Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ATP5F1 (ATP5PB) (NM_001688) Human Tagged ORF Clone Lentiviral Particle
RC205088L1V

USD 820.00

3 Weeks

Lenti ORF particles, ATP5F1 (Myc-DDK tagged) - Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ATP5F1 (ATP5PB) (NM_001688) Human Tagged ORF Clone Lentiviral Particle
RC205088L2V

USD 820.00

6 Weeks

Lenti ORF particles, ATP5F1 (mGFP-tagged) - Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ATP5F1 (ATP5PB) (NM_001688) Human Tagged ORF Clone
RC205088L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP5F1 (ATP5PB) (NM_001688) Human Tagged ORF Clone Lentiviral Particle
RC205088L3V

USD 820.00

5 Weeks

Lenti ORF particles, ATP5F1 (Myc-DDK tagged) - Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP5F1 (ATP5PB) (NM_001688) Human Tagged ORF Clone
RC205088L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP5F1 (ATP5PB) (NM_001688) Human Tagged ORF Clone Lentiviral Particle
RC205088L4V

USD 820.00

7 Weeks

Lenti ORF particles, ATP5F1 (mGFP-tagged) - Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP5PB (NM_001688) Human Tagged ORF Clone
RG205088

USD 460.00

3 Weeks

ATP5F1 (GFP-tagged) - Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP5F1 (ATP5PB) (NM_001688) Human Tagged ORF Clone
RC205088L1

USD 768.00

In Stock

Lenti ORF clone of Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ATP5PB Rabbit Polyclonal Antibody
TA346561

USD 475.00

5 Days

Rabbit Polyclonal Anti-ATP5F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP5F1 antibody: synthetic peptide directed towards the middle region of human ATP5F1. Synthetic peptide located within the following region: VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST
ATP5F1 (ATP5PB) (NM_001688) Human Tagged ORF Clone
RC205088L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ATP5PB (NM_001688) Human Recombinant Protein
TP760117

USD 215.00

In Stock

Recombinant protein of human ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
ATP5PB (NM_001688) Human Untagged Clone
SC319758

USD 310.00

In Stock

ATP5F1 (untagged)-Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ATP5PB (NM_001688) Human Over-expression Lysate
LY400645

USD 396.00

5 Days

Transient overexpression lysate of ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ATP5PB Rabbit Polyclonal Antibody
TA328112

USD 450.00

5 Days

Rabbit polyclonal anti-ATP5F1 antibody (Center)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This ATP5F1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 161-195 amino acids from the Central region of human ATP5F1.
ATP5PB Goat Polyclonal Antibody
TA329080

USD 375.00

5 Days

ATP5F1 (aa142-153) Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Internal region (SIQHIQNAIDTE)
ATP5F1 (83-256, His-tag) Human Protein
AR51336PU-N

USD 845.00

2 Weeks

ATP5F1 (83-256, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
ATP5F1 (83-256, His-tag) Human Protein
AR51336PU-S

USD 330.00

2 Weeks

ATP5F1 (83-256, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
ATP5PB (NM_001688) Human Over-expression Lysate
LC400645

USD 121.00

2 Weeks

ATP5F1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
ATP5PB ICC Control Block
TB405088

USD 1,040.00

4 Weeks

Transient overexpression of ATP5PB (NM_001688) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ATP5PB Cytosection
TS405088

USD 225.00

4 Weeks

Transient overexpression of ATP5PB (NM_001688) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ATP5PB Cytosection
TS405088P5

USD 889.00

4 Weeks

Transient overexpression of ATP5PB (NM_001688) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack