Products

View as table Download

NDUFB10 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

NDUFB10 (GFP-tagged) - Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NDUFB10 (Myc-DDK tagged) - Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, NDUFB10 (mGFP-tagged) - Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

NDUFB10 (untagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (cDNA clone MGC:4153 IMAGE:3030207), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal anti-NDUFB10 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFB10.

Purified recombinant protein of Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein, full length, with N-terminal HIS tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli

NDUFB10 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human

NDUFB10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

NDUFB10 (untagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal NDUFB10 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NDUFB10 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 43-70 amino acids from the Central region of human NDUFB10.

Rabbit Polyclonal Anti-NDUFB10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDUFB10 antibody is: synthetic peptide directed towards the C-terminal region of NDUFB10. Synthetic peptide located within the following region: KVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDL

Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody,clone OTI2B4

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody,clone OTI4D1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody, clone OTI4F1 (formerly 4F1)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

NDUFB10 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

NDUFB10 mouse monoclonal antibody,clone 1H6, Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

NDUFB10 mouse monoclonal antibody,clone 1H6, HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP

NDUFB10 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

NDUFB10 mouse monoclonal antibody,clone OTI2B4

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

NDUFB10 mouse monoclonal antibody,clone 2B4, Biotinylated

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

NDUFB10 mouse monoclonal antibody,clone 2B4, HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

NDUFB10 mouse monoclonal antibody,clone OTI2B4

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

NDUFB10 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NDUFB10 mouse monoclonal antibody,clone 2G1, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

NDUFB10 mouse monoclonal antibody,clone 2G1, HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

NDUFB10 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NDUFB10 mouse monoclonal antibody,clone OTI4D1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NDUFB10 mouse monoclonal antibody,clone OTI4D1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NDUFB10 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

NDUFB10 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

NDUFB10 mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

NDUFB10 mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

NDUFB10 mouse monoclonal antibody, clone OTI4F1 (formerly 4F1)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

NDUFB10 mouse monoclonal antibody,clone 4F1, Biotinylated

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

NDUFB10 mouse monoclonal antibody,clone 4F1, HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

NDUFB10 mouse monoclonal antibody, clone OTI4F1 (formerly 4F1)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated