NDUFB10 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NDUFB10 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NDUFB10 (GFP-tagged) - Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NDUFB10 (Myc-DDK tagged) - Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NDUFB10 (mGFP-tagged) - Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
NDUFB10 (untagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (cDNA clone MGC:4153 IMAGE:3030207), complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-NDUFB10 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFB10. |
Purified recombinant protein of Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein, full length, with N-terminal HIS tag, expressed in E. coli, 50ug
Tag | N-His |
Expression Host | E. coli |
NDUFB10 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
NDUFB10 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
NDUFB10 (untagged)-Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit polyclonal NDUFB10 Antibody (Center)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NDUFB10 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 43-70 amino acids from the Central region of human NDUFB10. |
Rabbit Polyclonal Anti-NDUFB10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NDUFB10 antibody is: synthetic peptide directed towards the C-terminal region of NDUFB10. Synthetic peptide located within the following region: KVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDL |
Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody,clone OTI2B4
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody,clone OTI4D1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody, clone OTI4F1 (formerly 4F1)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
NDUFB10 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
NDUFB10 mouse monoclonal antibody,clone 1H6, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
NDUFB10 mouse monoclonal antibody,clone 1H6, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
NDUFB10 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NDUFB10 mouse monoclonal antibody,clone OTI2B4
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
NDUFB10 mouse monoclonal antibody,clone 2B4, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
NDUFB10 mouse monoclonal antibody,clone 2B4, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
NDUFB10 mouse monoclonal antibody,clone OTI2B4
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
NDUFB10 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
NDUFB10 mouse monoclonal antibody,clone 2G1, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
NDUFB10 mouse monoclonal antibody,clone 2G1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
NDUFB10 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NDUFB10 mouse monoclonal antibody,clone OTI4D1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
NDUFB10 mouse monoclonal antibody,clone 4D1, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
NDUFB10 mouse monoclonal antibody,clone 4D1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
NDUFB10 mouse monoclonal antibody,clone OTI4D1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NDUFB10 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
NDUFB10 mouse monoclonal antibody,clone 2H10, Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
NDUFB10 mouse monoclonal antibody,clone 2H10, HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
NDUFB10 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NDUFB10 mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
NDUFB10 mouse monoclonal antibody,clone 5C12, Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
NDUFB10 mouse monoclonal antibody,clone 5C12, HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
NDUFB10 mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NDUFB10 mouse monoclonal antibody, clone OTI4F1 (formerly 4F1)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
NDUFB10 mouse monoclonal antibody,clone 4F1, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
NDUFB10 mouse monoclonal antibody,clone 4F1, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
NDUFB10 mouse monoclonal antibody, clone OTI4F1 (formerly 4F1)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |