Products

View as table Download

IFNA13 (GFP-tagged) - Human interferon, alpha 13 (IFNA13)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human interferon, alpha 1 (IFNA1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

IFNA13 (untagged)-Human interferon alpha 13 (IFNA13)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-IFNA13 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-IFNA13 antibody: synthetic peptide directed towards the C terminal of human IFNA13. Synthetic peptide located within the following region: ILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

IFNA13 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

IFNA13 (untagged)-Human interferon, alpha 13 (IFNA13)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of IFNA13 (NM_006900) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of IFNA13 (NM_006900) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of IFNA13 (NM_006900) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack