IFNA13 (Myc-DDK-tagged)-Human interferon, alpha 13 (IFNA13)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IFNA13 (Myc-DDK-tagged)-Human interferon, alpha 13 (IFNA13)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human interferon, alpha 13 (IFNA13), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, IFNA13 (Myc-DDK tagged) - Human interferon, alpha 13 (IFNA13), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interferon, alpha 13 (IFNA13), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, IFNA13 (mGFP-tagged) - Human interferon, alpha 13 (IFNA13), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
IFNA13 (GFP-tagged) - Human interferon, alpha 13 (IFNA13)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human interferon, alpha 1 (IFNA1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interferon, alpha 1 (IFNA1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
IFNA13 (untagged)-Human interferon alpha 13 (IFNA13)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-IFNA13 Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-IFNA13 antibody: synthetic peptide directed towards the C terminal of human IFNA13. Synthetic peptide located within the following region: ILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
IFNA13 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of interferon, alpha 13 (IFNA13)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
IFNA13 (untagged)-Human interferon, alpha 13 (IFNA13)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of IFNA13 (NM_006900) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IFNA13 (NM_006900) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IFNA13 (NM_006900) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack