Products

cDNA Clones (7)
Proteins (5)
Antibodies (1)
Jump to Filters
View as table Download
ENDOD1 (NM_015036) Human Tagged ORF Clone
RC217810

USD 420.00

In Stock

ENDOD1 (Myc-DDK-tagged)-Human endonuclease domain containing 1 (ENDOD1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ENDOD1 (NM_015036) Human Tagged ORF Clone
RC217810L3

USD 620.00

3 Weeks

Lenti ORF clone of Human endonuclease domain containing 1 (ENDOD1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ENDOD1 (NM_015036) Human Tagged ORF Clone Lentiviral Particle
RC217810L3V

USD 820.00

6 Weeks

Lenti ORF particles, ENDOD1 (Myc-DDK tagged) - Human endonuclease domain containing 1 (ENDOD1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ENDOD1 (NM_015036) Human Tagged ORF Clone
RC217810L4

USD 620.00

3 Weeks

Lenti ORF clone of Human endonuclease domain containing 1 (ENDOD1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ENDOD1 (NM_015036) Human Tagged ORF Clone Lentiviral Particle
RC217810L4V

USD 820.00

6 Weeks

Lenti ORF particles, ENDOD1 (mGFP-tagged) - Human endonuclease domain containing 1 (ENDOD1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ENDOD1 (NM_015036) Human Tagged ORF Clone
RG217810

USD 460.00

3 Weeks

ENDOD1 (GFP-tagged) - Human endonuclease domain containing 1 (ENDOD1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ENDOD1 Rabbit Polyclonal Antibody
TA333853

USD 375.00

5 Days

Rabbit Polyclonal Anti-ENDOD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENDOD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human ENDOD1. Synthetic peptide located within the following region: DLQKLLPFNPQLFQNNCGETEQDTEKMKKILEVVNQIQDEERMVQSQKSS
ENDOD1 (NM_015036) Human Over-expression Lysate
LC414838

USD 187.00

2 Weeks

ENDOD1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ENDOD1 (NM_015036) Human Over-expression Lysate
LY414838

USD 605.00

5 Days

Transient overexpression lysate of endonuclease domain containing 1 (ENDOD1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ENDOD1 (NM_015036) Human Untagged Clone
SC316227

USD 760.00

3 Weeks

ENDOD1 (untagged)-Human endonuclease domain containing 1 (ENDOD1)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ENDOD1 (NM_015036) ICC Control Block
TB417810

USD 1,070.00

4 Weeks

Transient overexpression of ENDOD1 (NM_015036) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ENDOD1 Cytosection
TS417810

USD 225.00

4 Weeks

Transient overexpression of ENDOD1 (NM_015036) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ENDOD1 Cytosection
TS417810P5

USD 889.00

4 Weeks

Transient overexpression of ENDOD1 (NM_015036) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack