Products

View as table Download

CYP4A22 (Myc-DDK-tagged)-Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CYP4A22 (Myc-DDK tagged) - Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CYP4A22 (mGFP-tagged) - Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CYP4A22 (GFP-tagged) - Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-CYP4A22 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ

Rabbit Polyclonal Anti-CYP4A22 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: AQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPS

CYP4A22 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CYP4A22 (untagged)-Human cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

USD 1,070.00

4 Weeks

Transient overexpression of CYP4A22 (NM_001010969) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of CYP4A22 (NM_001010969) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CYP4A22 (NM_001010969) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack