Products

cDNA Clones (11)
Proteins (6)
Antibodies (3)
Jump to Filters
View as table Download
Glutathione Peroxidase 3 (GPX3) (NM_002084) Human Tagged ORF Clone
RG207758

USD 460.00

In Stock

GPX3 (GFP-tagged) - Human glutathione peroxidase 3 (plasma) (GPX3), (10ug,) (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)

Vector pCMV6-AC-GFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Glutathione Peroxidase 3 (GPX3) (NM_002084) Human Tagged ORF Clone
RC207758

USD 98.00

USD 390.00

In Stock

GPX3 (Myc-DDK-tagged)-Human glutathione peroxidase 3 (plasma) (GPX3), (Note, selenocysteine protein, internal stop codon, see reference data summary)

Vector pCMV6-Entry
Mammalian Cell Selection Neomycin
  • TrueORF®
Glutathione Peroxidase 3 (GPX3) (NM_002084) Human Tagged ORF Clone Lentiviral Particle
RC207758L1V

USD 820.00

3 Weeks

Lenti ORF particles, GPX3 (Myc-DDK-tagged)-Human glutathione peroxidase 3 (plasma) (GPX3), (Note, selenocystein protein, internal stop codon, see summary), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Glutathione Peroxidase 3 (GPX3) (NM_002084) Human Tagged ORF Clone Lentiviral Particle
RC207758L2V

USD 820.00

6 Weeks

Lenti ORF particles, GPX3 (mGFP-tagged) - Human glutathione peroxidase 3 (plasma) (GPX3), (10ug,) (Note: selenocystein protein, Internal stop codon present. See Summary below), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Glutathione Peroxidase 3 (GPX3) (NM_002084) Human Tagged ORF Clone
RC207758L3

USD 620.00

3 Weeks

Lenti-ORF, GPX3 (Myc-DDK-tagged)-Human glutathione peroxidase 3 (plasma) (GPX3), (Note, selenocystein protein, internal stop codon, see summary)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Glutathione Peroxidase 3 (GPX3) (NM_002084) Human Tagged ORF Clone Lentiviral Particle
RC207758L3V

USD 820.00

5 Weeks

Lenti ORF particles, GPX3 (Myc-DDK-tagged)-Human glutathione peroxidase 3 (plasma) (GPX3), (Note, selenocystein protein, internal stop codon, see summary), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Glutathione Peroxidase 3 (GPX3) (NM_002084) Human Tagged ORF Clone
RC207758L4

USD 620.00

3 Weeks

Lenti-ORF, GPX3 (mGFP-tagged) - Human glutathione peroxidase 3 (plasma) (GPX3), (10ug,) (Note: selenocystein protein, Internal stop codon present. See Summary below)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Glutathione Peroxidase 3 (GPX3) (NM_002084) Human Tagged ORF Clone Lentiviral Particle
RC207758L4V

USD 820.00

7 Weeks

Lenti ORF particles, GPX3 (mGFP-tagged) - Human glutathione peroxidase 3 (plasma) (GPX3), (10ug,) (Note: selenocystein protein, Internal stop codon present. See Summary below), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Glutathione Peroxidase 3 (GPX3) (NM_002084) Human Untagged Clone
SC118819

USD 310.00

In Stock

GPX3 (untagged)-Human glutathione peroxidase 3 (plasma) (GPX3) (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)

Vector pCMV6-XL4
Mammalian Cell Selection None
Glutathione Peroxidase 3 (GPX3) (NM_002084) Human Tagged ORF Clone
RC207758L1

USD 768.00

In Stock

Lenti-ORF, GPX3 (Myc-DDK-tagged)-Human glutathione peroxidase 3 (plasma) (GPX3), (Note, selenocystein protein, internal stop codon, see summary)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Glutathione Peroxidase 3 (GPX3) Rabbit Polyclonal Antibody
TA346086

USD 475.00

5 Days

Rabbit Polyclonal Anti-GPX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI
Glutathione Peroxidase 3 (GPX3) (102-114) Goat Polyclonal Antibody
AP22523PU-N

USD 440.00

2 Weeks

Glutathione Peroxidase 3 (GPX3) (102-114) goat polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Bat, Bovine, Canine, Equine, Human, Monkey, Mouse, Porcine, Rat
Immunogen Synthetic peptide from internal region of human GPX3
Glutathione Peroxidase 3 (GPX3) (NM_002084) Human Tagged ORF Clone
RC207758L2

USD 620.00

3 Weeks

Lenti-ORF, GPX3 (mGFP-tagged) - Human glutathione peroxidase 3 (plasma) (GPX3), (10ug,) (Note: selenocystein protein, Internal stop codon present. See Summary below)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Glutathione Peroxidase 3 (GPX3) (NM_002084) Human Recombinant Protein
TP762166

USD 215.00

In Stock

Purified recombinant protein of Human glutathione peroxidase 3 (plasma) (GPX3), Gln21-Tyr72, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
Glutathione Peroxidase 3 (GPX3) Rabbit Polyclonal Antibody
TA309678

USD 424.00

5 Days

Rabbit Polyclonal Glutathione Peroxidase 3 Antibody

Applications WB
Reactivities Human, Primate, Rat
Conjugation Unconjugated
Immunogen Full length human GPX3 protein [Swiss-Prot# P22352] expressed in E. coli.
Glutathione peroxidase 3 / GPX3 (21-226, His-tag) Human Protein
AR50254PU-N

USD 1,105.00

2 Weeks

Glutathione peroxidase 3 / GPX3 (21-226, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
Glutathione peroxidase 3 / GPX3 (21-226, His-tag) Human Protein
AR50254PU-S

USD 415.00

2 Weeks

Glutathione peroxidase 3 / GPX3 (21-226, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Glutathione Peroxidase 3 (GPX3) ICC Control Block
TB407758

USD 1,040.00

4 Weeks

Transient overexpression of GPX3 (NM_002084) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Glutathione Peroxidase 3 (GPX3) Cytosection
TS407758

USD 225.00

4 Weeks

Transient overexpression of GPX3 (NM_002084) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Glutathione Peroxidase 3 (GPX3) Cytosection
TS407758P5

USD 889.00

4 Weeks

Transient overexpression of GPX3 (NM_002084) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack