Products

View as table Download

PLA2G2C (Myc-DDK-tagged)-Human phospholipase A2, group IIC (PLA2G2C)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human phospholipase A2, group IIC (PLA2G2C), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human phospholipase A2, group IIC (PLA2G2C), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PLA2G2C (GFP-tagged) - Human phospholipase A2, group IIC (PLA2G2C)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-PLA2G2C Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-PLA2G2C antibody is: synthetic peptide directed towards the middle region of Human PLA2G2C. Synthetic peptide located within the following region: LGDKGIPVDDTDSPSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTL

PLA2G2C HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PLA2G2C (untagged)-Human phospholipase A2, group IIC (PLA2G2C)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of PLA2G2C (NM_001105572) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of PLA2G2C (NM_001105572) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of PLA2G2C (NM_001105572) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack