Products

View as table Download

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DO beta (HLA-DOB)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

HLA (GFP-tagged) - Human major histocompatibility complex, class II, DO beta (HLA-DOB)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human major histocompatibility complex, class II, DO beta (HLA-DOB), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HLA (Myc-DDK tagged) - Human major histocompatibility complex, class II, DO beta (HLA-DOB), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human major histocompatibility complex, class II, DO beta (HLA-DOB), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HLA (mGFP-tagged) - Human major histocompatibility complex, class II, DO beta (HLA-DOB), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit polyclonal anti-HLA-DOB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HLA-DOB.

HLA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

(untagged)-Homo sapiens, clone MGC:31921 IMAGE:4565687, complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

HLA (untagged)-Human major histocompatibility complex, class II, DO beta (HLA-DOB)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression lysate of major histocompatibility complex, class II, DO beta (HLA-DOB)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-HLA-DOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-DOB antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-DOB. Synthetic peptide located within the following region: LTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVR

HLA class II DO beta / HLA-DOB (27-224, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

HLA class II DO beta / HLA-DOB (27-224, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

HLA MS Standard C13 and N15-labeled recombinant protein (NP_002111)

Tag C-Myc/DDK
Expression Host HEK293

Transient overexpression of HLA-DOB (NM_002120) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of HLA-DOB (NM_002120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of HLA-DOB (NM_002120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack