Products

View as table Download

IFNA7 (Myc-DDK-tagged)-Human interferon, alpha 7 (IFNA7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

IFNA7 (GFP-tagged) - Human interferon, alpha 7 (IFNA7)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human interferon, alpha 7 (IFNA7), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human interferon, alpha 7 (IFNA7), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human interferon, alpha 7 (IFNA7), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human interferon, alpha 7 (IFNA7), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Transient overexpression lysate of interferon, alpha 7 (IFNA7)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-IFNA7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IFNA7 Antibody: synthetic peptide directed towards the N terminal of human IFNA7. Synthetic peptide located within the following region: RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ

IFNA7 / Interferon alpha-7 (24-189, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli

IFNA7 / Interferon alpha-7 (24-189, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

IFNA7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

IFNA7 (untagged)-Human interferon, alpha 7 (IFNA7)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

USD 1,070.00

4 Weeks

Transient overexpression of IFNA7 (NM_021057) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of IFNA7 (NM_021057) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of IFNA7 (NM_021057) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack