IFNA7 (Myc-DDK-tagged)-Human interferon, alpha 7 (IFNA7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IFNA7 (Myc-DDK-tagged)-Human interferon, alpha 7 (IFNA7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, IFNA7 (Myc-DDK tagged) - Human interferon, alpha 7 (IFNA7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, IFNA7 (mGFP-tagged) - Human interferon, alpha 7 (IFNA7), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
IFNA7 (GFP-tagged) - Human interferon, alpha 7 (IFNA7)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human interferon, alpha 7 (IFNA7), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IFNA7 (Myc-DDK tagged) - Human interferon, alpha 7 (IFNA7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interferon, alpha 7 (IFNA7), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IFNA7 (mGFP-tagged) - Human interferon, alpha 7 (IFNA7), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interferon, alpha 7 (IFNA7), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human interferon, alpha 7 (IFNA7), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Transient overexpression lysate of interferon, alpha 7 (IFNA7)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-IFNA7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IFNA7 Antibody: synthetic peptide directed towards the N terminal of human IFNA7. Synthetic peptide located within the following region: RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ |
IFNA7 / Interferon alpha-7 (24-189, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
IFNA7 / Interferon alpha-7 (24-189, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
IFNA7 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
IFNA7 (untagged)-Human interferon, alpha 7 (IFNA7)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of IFNA7 (NM_021057) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IFNA7 (NM_021057) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IFNA7 (NM_021057) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack