USD 98.00
USD 390.00
In Stock
CHP1 (Myc-DDK-tagged)-Human calcium binding protein P22 (CHP)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 98.00
USD 390.00
In Stock
CHP1 (Myc-DDK-tagged)-Human calcium binding protein P22 (CHP)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
4 Weeks
Lenti ORF particles, CHP1 (Myc-DDK tagged) - Human calcium binding protein P22 (CHP), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, CHP1 (mGFP-tagged) - Human calcium binding protein P22 (CHP), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 823.00
In Stock
Recombinant protein of human calcium binding protein P22 (CHP)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CHP1 (GFP-tagged) - Human calcium binding protein P22 (CHP)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human calcium binding protein P22 (CHP), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CHP1 (Myc-DDK tagged) - Human calcium binding protein P22 (CHP), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human calcium binding protein P22 (CHP), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CHP1 (mGFP-tagged) - Human calcium binding protein P22 (CHP), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal antibody to Calcium binding protein P22
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 47 and 141 of Calcium binding protein P22 (Uniprot ID#Q99653) |
Rabbit Polyclonal Anti-CHP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM |
USD 121.00
In Stock
CHP1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 620.00
In Stock
Lenti ORF clone of Human calcium binding protein P22 (CHP), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human calcium binding protein P22 (CHP), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-CHP antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CHP. |
(untagged)-Human cDNA FLJ36630 fis, clone TRACH2018278
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CHP1 (untagged)-Human calcium binding protein P22 (CHP)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Calcium-binding protein p22 (1-195, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
Calcium-binding protein p22 (1-195, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) CHP mouse monoclonal antibody,clone OTI3H3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CHP mouse monoclonal antibody,clone OTI2E2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CHP1 mouse monoclonal antibody,clone OTI1D11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CHP1 mouse monoclonal antibody,clone OTI6F5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CHP mouse monoclonal antibody,clone OTI4B9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 396.00
5 Days
Transient overexpression lysate of calcium binding protein P22 (CHP)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 2,055.00
3 Weeks
CHP MS Standard C13 and N15-labeled recombinant protein (NP_009167)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
USD 379.00
In Stock
CHP mouse monoclonal antibody,clone OTI3H3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CHP mouse monoclonal antibody,clone OTI3H3, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
CHP mouse monoclonal antibody,clone OTI3H3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
CHP mouse monoclonal antibody,clone OTI3H3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
CHP mouse monoclonal antibody,clone OTI2E2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CHP mouse monoclonal antibody,clone OTI2E2, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
CHP mouse monoclonal antibody,clone OTI2E2, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
CHP mouse monoclonal antibody,clone OTI2E2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
CHP1 mouse monoclonal antibody,clone OTI1D11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CHP1 mouse monoclonal antibody,clone OTI1D11, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
CHP1 mouse monoclonal antibody,clone OTI1D11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
CHP1 mouse monoclonal antibody,clone OTI1D11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
CHP1 mouse monoclonal antibody,clone OTI6F5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CHP1 mouse monoclonal antibody,clone OTI6F5, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
CHP1 mouse monoclonal antibody,clone OTI6F5, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
CHP1 mouse monoclonal antibody,clone OTI6F5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
CHP mouse monoclonal antibody,clone OTI4B9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CHP mouse monoclonal antibody,clone OTI4B9, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
CHP mouse monoclonal antibody,clone OTI4B9, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
CHP mouse monoclonal antibody,clone OTI4B9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of CHP1 (NM_007236) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CHP1 (NM_007236) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CHP1 (NM_007236) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack