Products

cDNA Clones (11)
Antibodies (6)
Proteins (3)
Jump to Filters
View as table Download
WNT10B (NM_003394) Human Tagged ORF Clone
RC212840

USD 420.00

In Stock

WNT10B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 10B (WNT10B)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
WNT10B (NM_003394) Human Tagged ORF Clone Lentiviral Particle
RC212840L1V

USD 820.00

3 Weeks

Lenti ORF particles, WNT10B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 10B (WNT10B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
WNT10B (NM_003394) Human Tagged ORF Clone Lentiviral Particle
RC212840L2V

USD 820.00

3 Weeks

Lenti ORF particles, WNT10B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 10B (WNT10B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
WNT10B (NM_003394) Human Tagged ORF Clone
RG212840

USD 460.00

In Stock

WNT10B (GFP-tagged) - Human wingless-type MMTV integration site family, member 10B (WNT10B)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
WNT10B (NM_003394) Human Tagged ORF Clone Lentiviral Particle
RC212840L3V

USD 820.00

5 Weeks

Lenti ORF particles, WNT10B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 10B (WNT10B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
WNT10B (NM_003394) Human Tagged ORF Clone
RC212840L4

USD 620.00

In Stock

Lenti ORF clone of Human wingless-type MMTV integration site family, member 10B (WNT10B), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
WNT10B (NM_003394) Human Tagged ORF Clone Lentiviral Particle
RC212840L4V

USD 820.00

3 Weeks

Lenti ORF particles, WNT10B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 10B (WNT10B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
WNT10B (NM_003394) Human Untagged Clone
SC310452

USD 760.00

In Stock

WNT10B (untagged)-Human wingless-type MMTV integration site family, member 10B (WNT10B)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
WNT10B (NM_003394) Human Tagged ORF Clone
RC212840L1

USD 768.00

In Stock

Lenti ORF clone of Human wingless-type MMTV integration site family, member 10B (WNT10B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
WNT10B (NM_003394) Human Tagged ORF Clone
RC212840L2

USD 620.00

In Stock

Lenti ORF clone of Human wingless-type MMTV integration site family, member 10B (WNT10B), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
WNT10B Rabbit Polyclonal Antibody
TA306582

USD 430.00

In Stock

Rabbit Polyclonal Wnt10b Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Wnt10b antibody was raised against a 15 amino acid peptide from near the center of human Wnt10b.
WNT10B Rabbit Polyclonal Antibody
TA344059

USD 475.00

5 Days

Rabbit Polyclonal Anti-WNT10B Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT10B antibody: synthetic peptide directed towards the middle region of human WNT10B. Synthetic peptide located within the following region: GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
WNT10B Rabbit Polyclonal Antibody
TA324853

USD 450.00

5 Days

Rabbit polyclonal WNT10B Antibody (Center)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This WNT10B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-222 amino acids from the Central region of human WNT10B.
WNT10B Rabbit Polyclonal Antibody
TA341205

USD 425.00

5 Days

Rabbit Polyclonal Anti-WNT10B Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT10B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10B. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Elephant, Dog, Bat, Horse, Rabbit, Pig (100%); Hamster (94%); Panda (88%).
WNT10B Rabbit Polyclonal Antibody
TA341206

USD 425.00

5 Days

Rabbit Polyclonal Anti-WNT10B Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen WNT10B antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT10B. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Hamster, Dog, Bat, Pig (100%); Marmoset, Elephant, Panda, Horse, Rabbit (93%).
WNT10B Rabbit Polyclonal Antibody
TA351953

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-WNT10B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT10B
WNT10B ICC Control Block
TB412840

USD 1,070.00

4 Weeks

Transient overexpression of WNT10B (NM_003394) in HEK293T cells paraffin embedded controls for ICC/IHC staining

WNT10B Cytosection
TS412840

USD 225.00

4 Weeks

Transient overexpression of WNT10B (NM_003394) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

WNT10B Cytosection
TS412840P5

USD 889.00

4 Weeks

Transient overexpression of WNT10B (NM_003394) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack