Germany
Japan
United Kingdom
China
TAF4 (Myc-DDK-tagged)-Human TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa (TAF4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadTAF4 (GFP-tagged) - Human TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa (TAF4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-TAF4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF4 Antibody: A synthesized peptide derived from human TAF4 |
Rabbit polyclonal anti-TAF4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAF4. |
Rabbit Polyclonal Anti-TAF4 Antibody
| Applications | 10k-ChIP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAF4 Antibody: synthetic peptide directed towards the middle region of human TAF4. Synthetic peptide located within the following region: EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRL |
TAF4 (untagged)-Human TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa (TAF4)
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of TAF4 (NM_003185) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TAF4 (NM_003185) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TAF4
Pathways
- Basal transcription factors