Products

View as table Download

UQCRFS1 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

UQCRFS1 (GFP-tagged) - Human ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of UQCRFS1 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1), nuclear gene encoding mitochondrial protein

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, UQCRFS1 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of UQCRFS1 (mGFP-tagged)-Human ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1), nuclear gene encoding mitochondrial protein

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, UQCRFS1 (mGFP-tagged)-Human ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal antibody to UQCRFS1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 274 of UQCRFS1 (Uniprot ID#P47985)

UQCRFS1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 188-217 amino acids from the C-terminal region of human UQCRFS1

Rabbit Polyclonal Anti-UQCRFS1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRFS1 antibody: synthetic peptide directed towards the N terminal of human UQCRFS1. Synthetic peptide located within the following region: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL

UQCRFS1 (untagged)-Human ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1), nuclear gene encoding mitochondrial protein

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

UQCRFS1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Carrier-free (BSA/glycerol-free) UQCRFS1 mouse monoclonal antibody,clone OTI4H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UQCRFS1 mouse monoclonal antibody,clone OTI4H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UQCRFS1 mouse monoclonal antibody,clone OTI4H8, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

UQCRFS1 mouse monoclonal antibody,clone OTI4H8, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

UQCRFS1 mouse monoclonal antibody,clone OTI4H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

USD 1,070.00

4 Weeks

Transient overexpression of UQCRFS1 (NM_006003) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of UQCRFS1 (NM_006003) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of UQCRFS1 (NM_006003) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack