Germany
Japan
United Kingdom
China
CD40LG (Myc-DDK-tagged)-Human CD40 ligand (CD40LG)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
CD40LG (untagged)-Human CD40 ligand (CD40LG)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CD40LG (GFP-tagged) - Human CD40 ligand (CD40LG)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
In Stock
Lenti ORF particles, CD40LG (Myc-DDK tagged) - Human CD40 ligand (CD40LG), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, CD40LG (mGFP-tagged) - Human CD40 ligand (CD40LG), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human CD40 ligand (CD40LG), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, CD40LG (Myc-DDK tagged) - Human CD40 ligand (CD40LG), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CD40 ligand (CD40LG), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, CD40LG (mGFP-tagged) - Human CD40 ligand (CD40LG), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human CD40 ligand (CD40LG).
| Tag | Tag Free |
| Expression Host | E. coli |
Purified recombinant protein of Human CD40 ligand (CD40LG / TNFSF5)
| Tag | N-His |
| Expression Host | HEK293 |
Transient overexpression lysate of CD40 ligand (CD40LG)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human CD40 ligand (CD40LG), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Lenti ORF clone of Human CD40 ligand (CD40LG), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CD40L (CD40LG) (C-term) rabbit polyclonal antibody
| Applications | FC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human TRAP |
CD40LG HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Purified
| Applications | FC |
| Reactivities | Human |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human TRAP |
Mouse Anti-Human CD154 (CD40 Ligand) Purified (25 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti CD154 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to aa 51-69 of human CD154. |
CD154 / CD40L (113-261, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
CD154 / CD40L (113-261, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
CD40LG (untagged)-Human CD40 ligand (CD40LG)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CD40LG |
USD 399.00
In Stock
Transient overexpression of CD40LG (NM_000074) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human CD40 ligand (CD40LG), the domain of Met113-Leu261
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human CD40 ligand (CD40LG), the domain of Met113-Leu261
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human CD40 ligand (CD40LG), the domain of Met113-Leu261
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human CD40 ligand (CD40LG), the domain of Met113-Leu261
| Tag | tag free |
| Expression Host | E. coli |
Transient overexpression of CD40LG (NM_000074) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CD40LG (NM_000074) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CD40LG
Pathways
- Cell adhesion molecules (CAMs)