Products

View as table Download

CLDN5 (Myc-DDK-tagged)-Human claudin 5 (CLDN5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CLDN5 (Myc-DDK-tagged)-Human claudin 5 (CLDN5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CLDN5 (GFP-tagged) - Human claudin 5 (CLDN5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CLDN5 (GFP-tagged) - Human claudin 5 (CLDN5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human claudin 5 (CLDN5), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human claudin 5 (CLDN5), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

CLDN5 (untagged)-Human claudin 5 (CLDN5), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-Claudin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5

CLDN5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit polyclonal anti-Claudin 5 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CLDN5.

Rabbit Polyclonal Anti-Claudin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig, Cow
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5

Lenti ORF clone of Human claudin 5 (CLDN5), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human claudin 5 (CLDN5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

CLDN5 (untagged)-Human claudin 5 (CLDN5), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal Claudin 5 (Tyr217) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Claudin 5 around the phosphorylation site of tyrosine 217 (K-N-YP-V).
Modifications Phospho-specific

CLDN5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-CLDN5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN5 antibody: synthetic peptide directed towards the C terminal of human CLDN5. Synthetic peptide located within the following region: GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN

Rabbit anti Claudin 5 Polyclonal Antibody

Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CLDN5 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications FC, IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CLDN5 (untagged)-Human claudin 5 (CLDN5) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Anti-CLDN5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 202-215 amino acids of Human claudin 5

Anti-CLDN5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 202-215 amino acids of Human claudin 5

CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications FC, IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications FC, IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Transient overexpression of CLDN5 (NM_003277) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CLDN5 (NM_001130861) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CLDN5 (NM_003277) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of CLDN5 (NM_003277) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of CLDN5 (NM_001130861) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of CLDN5 (NM_001130861) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack