SOS1 (Myc-DDK-tagged)-Human son of sevenless homolog 1 (Drosophila) (SOS1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
SOS1 (Myc-DDK-tagged)-Human son of sevenless homolog 1 (Drosophila) (SOS1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SOS1 (Myc-DDK tagged) - Human son of sevenless homolog 1 (Drosophila) (SOS1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, SOS1 (mGFP-tagged) - Human son of sevenless homolog 1 (Drosophila) (SOS1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
SOS1 (GFP-tagged) - Human son of sevenless homolog 1 (Drosophila) (SOS1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human son of sevenless homolog 1 (Drosophila) (SOS1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SOS1 (Myc-DDK tagged) - Human son of sevenless homolog 1 (Drosophila) (SOS1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human son of sevenless homolog 1 (Drosophila) (SOS1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SOS1 (mGFP-tagged) - Human son of sevenless homolog 1 (Drosophila) (SOS1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human son of sevenless homolog 1 (Drosophila) (SOS1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
SOS1 (untagged)-Human son of sevenless homolog 1 (Drosophila) (SOS1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
SOS1 mouse monoclonal antibody, clone SOS-1, Aff - Purified
Applications | ELISA, IF, WB |
Reactivities | Human, Mouse |
Lenti ORF clone of Human son of sevenless homolog 1 (Drosophila) (SOS1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-SOS1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Sos1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Sos1. Synthetic peptide located within the following region: YFELLKQLEEKSEDQEDKECMKQAITALLNVQSGMEKICSKSLAKRRLSE |
Transient overexpression of SOS1 (NM_005633) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SOS1 (NM_005633) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SOS1 (NM_005633) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack