FZD9 (Myc-DDK-tagged)-Human frizzled family receptor 9 (FZD9)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
FZD9 (Myc-DDK-tagged)-Human frizzled family receptor 9 (FZD9)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 880.00
3 Weeks
Lenti ORF particles, FZD9 (Myc-DDK tagged) - Human frizzled family receptor 9 (FZD9), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 880.00
6 Weeks
Lenti ORF particles, FZD9 (mGFP-tagged) - Human frizzled family receptor 9 (FZD9), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
FZD9 (GFP-tagged) - Human frizzled family receptor 9 (FZD9)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human frizzled family receptor 9 (FZD9), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 880.00
7 Weeks
Lenti ORF particles, FZD9 (Myc-DDK tagged) - Human frizzled family receptor 9 (FZD9), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 880.00
3 Weeks
Lenti ORF particles, FZD9 (mGFP-tagged) - Human frizzled family receptor 9 (FZD9), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
FZD9 (untagged)-Human frizzled family receptor 9 (FZD9)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-FZD9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Rabbit polyclonal anti-FZD9 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human FZD9. |
Lenti ORF clone of Human frizzled family receptor 9 (FZD9), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
FZD9 (untagged)-Human frizzled homolog 9 (Drosophila) (cDNA clone MGC:26396 IMAGE:4791657), complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-FZD9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: TRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGS |
FZD9 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of frizzled homolog 9 (Drosophila) (FZD9)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human frizzled family receptor 9 (FZD9), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-FZD9 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human FZD9. |
Rabbit Polyclonal Anti-FZD9 Antibody (Extracellular Domain)
Applications | IHC |
Reactivities | Human |
Immunogen | FZD9 / Frizzled 9 antibody was raised against synthetic 14 amino acid peptide from 1st extracellular domain of human FZD9 / Frizzled 9. Percent identity with other species by BLAST analysis: Human, Gibbon, Mouse, Rat, Hamster, Panda, Dog, Bovine, Bat, Rabbit, Opossum (100%); Platypus (86%). |
Rabbit Polyclonal Anti-FZD9 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | FZD9 / Frizzled 9 antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human FZD9 / Frizzled 9. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Mouse, Rat, Bovine (93%). |
Transient overexpression of FZD9 (NM_003508) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of FZD9 (NM_003508) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FZD9 (NM_003508) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack