Products

cDNA Clones (11)
Proteins (6)
Antibodies (4)
Jump to Filters
View as table Download
Factor XI (F11) (NM_000128) Human Tagged ORF Clone
RG213056

USD 460.00

In Stock

F11 (GFP-tagged) - Human coagulation factor XI (F11)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Factor XI (F11) (NM_000128) Human Tagged ORF Clone
RC213056L3

USD 620.00

3 Weeks

Lenti ORF clone of Human coagulation factor XI (F11), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Factor XI (F11) (NM_000128) Human Tagged ORF Clone
RC213056L4

USD 620.00

In Stock

Lenti ORF clone of Human coagulation factor XI (F11), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Factor XI (F11) (NM_000128) Human Untagged Clone
SC109207

USD 760.00

In Stock

F11 (untagged)-Human coagulation factor XI (F11)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Factor XI (F11) (NM_000128) Human Over-expression Lysate
LC400043

USD 187.00

In Stock

F11 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Factor XI (F11) (NM_000128) Human Tagged ORF Clone
RC213056L2

USD 620.00

3 Weeks

Lenti ORF clone of Human coagulation factor XI (F11), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Factor XI (F11) (NM_019559) Human Untagged Clone
SC304677

USD 660.00

In Stock

F11 (untagged)-Human coagulation factor XI (plasma thromboplastin antecedent) (F11), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Factor XI (F11) Goat Polyclonal Antibody
AP21465SU-N

USD 550.00

2 Weeks

Factor XI (F11) goat polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen Plasma FXI.
Freund’s complete adjuvant is used in the first step of the immunization.
Factor XI (F11) (Center) Rabbit Polyclonal Antibody
AP51492PU-N

USD 512.00

2 Weeks

Factor XI (F11) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 281-307 amino acids from the Central region of human F11.
Factor XI (F11) Rabbit Polyclonal Antibody
TA308541

USD 415.00

5 Days

Rabbit Polyclonal antibody to Factor XI (coagulation factor XI)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 312 of Factor XI (Uniprot ID#P03951)
Factor XI (F11) Rabbit Polyclonal Antibody
TA343100

USD 375.00

5 Days

Rabbit Polyclonal Anti-F11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F11 antibody: synthetic peptide directed towards the C terminal of human F11. Synthetic peptide located within the following region: RHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFG
Factor XI (F11) (NM_000128) Human Mass Spec Standard
PH313056

USD 2,055.00

3 Weeks

F11 MS Standard C13 and N15-labeled recombinant protein (NP_000119)

Tag C-Myc/DDK
Expression Host HEK293
Factor XI (F11) ICC Control Block
TB413056

USD 1,070.00

4 Weeks

Transient overexpression of F11 (NM_000128) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Factor XI (F11) Cytosection
TS413056

USD 225.00

4 Weeks

Transient overexpression of F11 (NM_000128) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Factor XI (F11) Cytosection
TS413056P5

USD 889.00

4 Weeks

Transient overexpression of F11 (NM_000128) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack