Products

View as table Download

Rabbit anti-SH3GL2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SH3GL2

Rabbit polyclonal Anti-SH3GL2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3GL2 antibody: synthetic peptide directed towards the middle region of human SH3GL2. Synthetic peptide located within the following region: PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD