Products

cDNA Clones (14)
Proteins (12)
Antibodies (2)
Jump to Filters
View as table Download
PSD3 (NM_206909) Human Tagged ORF Clone
RC220354

USD 470.00

In Stock

PSD3 (Myc-DDK-tagged)-Human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PSD3 (NM_015310) Human Tagged ORF Clone
RC220303

USD 1,100.00

In Stock

PSD3 (Myc-DDK-tagged)-Human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PSD3 (NM_015310) Human Tagged ORF Clone
RC220303L3

USD 1,300.00

3 Weeks

Lenti ORF clone of Human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSD3 (NM_015310) Human Tagged ORF Clone Lentiviral Particle
RC220303L3V

USD 1,500.00

6 Weeks

Lenti ORF particles, PSD3 (Myc-DDK tagged) - Human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSD3 (NM_015310) Human Tagged ORF Clone
RC220303L4

USD 1,300.00

3 Weeks

Lenti ORF clone of Human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSD3 (NM_015310) Human Tagged ORF Clone Lentiviral Particle
RC220303L4V

USD 1,500.00

6 Weeks

Lenti ORF particles, PSD3 (mGFP-tagged) - Human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSD3 (NM_206909) Human Tagged ORF Clone
RC220354L3

USD 670.00

3 Weeks

Lenti ORF clone of Human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSD3 (NM_206909) Human Tagged ORF Clone Lentiviral Particle
RC220354L3V

USD 870.00

6 Weeks

Lenti ORF particles, PSD3 (Myc-DDK tagged) - Human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSD3 (NM_206909) Human Tagged ORF Clone
RC220354L4

USD 670.00

3 Weeks

Lenti ORF clone of Human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSD3 (NM_206909) Human Tagged ORF Clone Lentiviral Particle
RC220354L4V

USD 870.00

6 Weeks

Lenti ORF particles, PSD3 (mGFP-tagged) - Human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSD3 (NM_015310) Human Tagged ORF Clone
RG220303

USD 1,210.00

3 Weeks

PSD3 (GFP-tagged) - Human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSD3 (NM_206909) Human Tagged ORF Clone
RG220354

USD 520.00

3 Weeks

PSD3 (GFP-tagged) - Human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSD3 Rabbit Polyclonal Antibody
TA344112

USD 410.00

5 Days

Rabbit Polyclonal Anti-PSD3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSD3 antibody: synthetic peptide directed towards the middle region of human PSD3. Synthetic peptide located within the following region: SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQ
PSD3 Rabbit Polyclonal Antibody
TA344113

USD 475.00

5 Days

Rabbit Polyclonal Anti-PSD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PSD3 antibody is: synthetic peptide directed towards the C-terminal region of Human PSD3. Synthetic peptide located within the following region: DESEAAGLKKSHSSPSLNPDTSPITAKVKRNVSERKDHRPETPSIKQKVT
PSD3 (NM_206909) Human Over-expression Lysate
LC404163

USD 187.00

2 Weeks

PSD3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSD3 (NM_015310) Human Over-expression Lysate
LC414642

USD 187.00

2 Weeks

PSD3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSD3 (NM_206909) Human Over-expression Lysate
LY404163

USD 605.00

5 Days

Transient overexpression lysate of pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSD3 (NM_015310) Human Over-expression Lysate
LY414642

USD 605.00

5 Days

Transient overexpression lysate of pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSD3 (NM_015310) Human Mass Spec Standard
PH320303

USD 2,055.00

3 Weeks

PSD3 MS Standard C13 and N15-labeled recombinant protein (NP_056125)

Tag C-Myc/DDK
Expression Host HEK293
PSD3 (NM_206909) Human Mass Spec Standard
PH320354

USD 2,055.00

3 Weeks

PSD3 MS Standard C13 and N15-labeled recombinant protein (NP_996792)

Tag C-Myc/DDK
Expression Host HEK293
PSD3 (NM_206909) Human Untagged Clone
SC308313

USD 870.00

3 Weeks

PSD3 (untagged)-Human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PSD3 (NM_015310) Human Untagged Clone
SC318467

USD 2,130.00

3 Weeks

PSD3 (untagged)-Human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PSD3 (NM_015310) ICC Control Block
TB420303

USD 1,750.00

4 Weeks

Transient overexpression of PSD3 (NM_015310) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PSD3 (NM_206909) ICC Control Block
TB420354

USD 1,120.00

4 Weeks

Transient overexpression of PSD3 (NM_206909) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PSD3 Cytosection
TS420303

USD 225.00

4 Weeks

Transient overexpression of PSD3 (NM_015310) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PSD3 Cytosection
TS420303P5

USD 889.00

4 Weeks

Transient overexpression of PSD3 (NM_015310) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PSD3 Cytosection
TS420354

USD 225.00

4 Weeks

Transient overexpression of PSD3 (NM_206909) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PSD3 Cytosection
TS420354P5

USD 889.00

4 Weeks

Transient overexpression of PSD3 (NM_206909) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack