Products

View as table Download

ATP6V0D1 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP6V0D1 (Myc-DDK tagged) - Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ATP6V0D1 (mGFP-tagged) - Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ATP6V0D1 (GFP-tagged) - Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ATP6V0D1 (untagged)-Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-ATP6V0D1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATP6V0D1 antibody is: synthetic peptide directed towards the C-terminal region of Human ATP6V0D1. Synthetic peptide located within the following region: KLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQ

Rabbit Polyclonal Anti-ATP6V0D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATP6V0D1 antibody is: synthetic peptide directed towards the C-terminal region of Human ATP6V0D1. Synthetic peptide located within the following region: GGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPE

ATP6V0D1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

ATP6V0D1 MS Standard C13 and N15-labeled recombinant protein (NP_004682)

Tag C-Myc/DDK
Expression Host HEK293

Transient overexpression of ATP6V0D1 (NM_004691) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of ATP6V0D1 (NM_004691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ATP6V0D1 (NM_004691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack