MAP2K7 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase 7 (MAP2K7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MAP2K7 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase 7 (MAP2K7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, MAP2K7 (Myc-DDK tagged) - Human mitogen-activated protein kinase kinase 7 (MAP2K7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, MAP2K7 (mGFP-tagged) - Human mitogen-activated protein kinase kinase 7 (MAP2K7), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
MAP2K7 (GFP-tagged) - Human mitogen-activated protein kinase kinase 7 (MAP2K7)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human mitogen-activated protein kinase kinase 7 (MAP2K7), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAP2K7 (Myc-DDK tagged) - Human mitogen-activated protein kinase kinase 7 (MAP2K7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human mitogen-activated protein kinase kinase 7 (MAP2K7), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAP2K7 (mGFP-tagged) - Human mitogen-activated protein kinase kinase 7 (MAP2K7), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MAP2K7 (myc-DDK-tagged) - Human mitogen-activated protein kinase kinase 7 (MAP2K7), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MAP2K7 (myc-DDK-tagged) - Human mitogen-activated protein kinase kinase 7 (MAP2K7), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human mitogen-activated protein kinase kinase 7 (MAP2K7), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
Modifications | Phospho-specific |
MAP2K7 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAP2K7 |
Transient overexpression lysate of mitogen-activated protein kinase kinase 7 (MAP2K7)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
MAP2K7 (untagged)-Human mitogen-activated protein kinase kinase 7 (MAP2K7)
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal MAP2K7 (Thr275) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of threonine 275 (A-K-TP-R-S). |
Modifications | Phospho-specific |
MAP2K7 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Purified recombinant protein of Human mitogen-activated protein kinase kinase 7 (MAP2K7), full length, with C-terminal His tag, expressed in E.coli, 51ug
Tag | C-His |
Expression Host | E. coli |
MEK7 (MAP2K7) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal anti-MAP2K7 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAP2K7 antibody: synthetic peptide directed towards the middle region of human MAP2K7. Synthetic peptide located within the following region: ERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVL |
MAP2K7 MS Standard C13 and N15-labeled recombinant protein (NP_660186)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
MAP2K7 (GFP-tagged) - Human mitogen-activated protein kinase kinase 7 (MAP2K7), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MAP2K7 (GFP-tagged) - Human mitogen-activated protein kinase kinase 7 (MAP2K7), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MAP2K7 (untagged) - Human mitogen-activated protein kinase kinase 7 (MAP2K7), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
MAP2K7 (untagged) - Human mitogen-activated protein kinase kinase 7 (MAP2K7), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of MAP2K7 (NM_145185) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAP2K7 (NM_001297556) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAP2K7 (NM_001297555) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAP2K7 (NM_145185) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAP2K7 (NM_145185) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MAP2K7 (NM_001297556) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MAP2K7 (NM_001297555) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAP2K7 (NM_001297555) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack