Products

Proteins (8)
cDNA Clones (7)
Antibodies (1)
Jump to Filters
View as table Download
PIP5K2 beta (PIP4K2B) (NM_003559) Human Tagged ORF Clone
RC218338L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K2 beta (PIP4K2B) (NM_003559) Human Tagged ORF Clone Lentiviral Particle
RC218338L3V

USD 820.00

6 Weeks

Lenti ORF particles, PIP4K2B (Myc-DDK tagged) - Human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K2 beta (PIP4K2B) (NM_003559) Human Tagged ORF Clone
RC218338L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K2 beta (PIP4K2B) (NM_003559) Human Tagged ORF Clone Lentiviral Particle
RC218338L4V

USD 820.00

6 Weeks

Lenti ORF particles, PIP4K2B (mGFP-tagged) - Human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K2 beta (PIP4K2B) (NM_003559) Human Tagged ORF Clone
RG218338

USD 460.00

3 Weeks

PIP4K2B (GFP-tagged) - Human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PIP5K2 beta (PIP4K2B) (NM_003559) Human Untagged Clone
SC111707

USD 710.00

In Stock

PIP4K2B (untagged)-Human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
PIP5K2 beta (PIP4K2B) (NM_003559) Human Over-expression Lysate
LC418600

USD 187.00

In Stock

PIP4K2B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PIP5K2 beta (PIP4K2B) Rabbit Polyclonal Antibody
TA332103

USD 375.00

5 Days

Rabbit Polyclonal Anti-PIP4K2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIP4K2B Antibody is: synthetic peptide directed towards the C-terminal region of Human PIP4K2B. Synthetic peptide located within the following region: DVYAMKSHESSPKKEVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEIS
PIP4K2B / PIP5K2B (1-416, His-tag) Human Protein
AR50766PU-N

USD 845.00

2 Weeks

PIP4K2B / PIP5K2B (1-416, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
PIP4K2B / PIP5K2B (1-416, His-tag) Human Protein
AR50766PU-S

USD 330.00

2 Weeks

PIP4K2B / PIP5K2B (1-416, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
PIP5K2 beta (PIP4K2B) (NM_003559) Human Over-expression Lysate
LY418600

USD 605.00

5 Days

Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PIP5K2 beta (PIP4K2B) (NM_003559) Human Mass Spec Standard
PH318338

USD 2,055.00

3 Weeks

PIP4K2B MS Standard C13 and N15-labeled recombinant protein (NP_003550)

Tag C-Myc/DDK
Expression Host HEK293
PIP5K2 beta (PIP4K2B) (NM_003559) ICC Control Block
TB418338

USD 1,070.00

4 Weeks

Transient overexpression of PIP4K2B (NM_003559) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PIP5K2 beta (PIP4K2B) Cytosection
TS418338

USD 225.00

4 Weeks

Transient overexpression of PIP4K2B (NM_003559) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PIP5K2 beta (PIP4K2B) Cytosection
TS418338P5

USD 889.00

4 Weeks

Transient overexpression of PIP4K2B (NM_003559) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack