Products

cDNA Clones (34)
Proteins (17)
Antibodies (2)
Jump to Filters
View as table Download
PIP5K1 alpha (PIP5K1A) (NM_001135638) Human Tagged ORF Clone
RC227689

USD 520.00

In Stock

PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PIP5K1 alpha (PIP5K1A) (NM_003557) Human Tagged ORF Clone
RC219870

USD 500.00

In Stock

PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PIP5K1 alpha (PIP5K1A) (NM_001135636) Human Tagged ORF Clone
RC227279

USD 470.00

In Stock

PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PIP5K1 alpha (PIP5K1A) (NM_003557) Human Tagged ORF Clone Lentiviral Particle
RC219870L1V

USD 900.00

3 Weeks

Lenti ORF particles, PIP5K1A (Myc-DDK tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_001135638) Human Tagged ORF Clone Lentiviral Particle
RC227689L1V

USD 920.00

3 Weeks

Lenti ORF particles, PIP5K1A (Myc-DDK tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_003557) Human Tagged ORF Clone
RG219870

USD 550.00

In Stock

PIP5K1A (GFP-tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PIP5K1 alpha (PIP5K1A) (NM_003557) Human Tagged ORF Clone
RC219870L3

USD 700.00

3 Weeks

Lenti ORF clone of Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_003557) Human Tagged ORF Clone Lentiviral Particle
RC219870L3V

USD 900.00

7 Weeks

Lenti ORF particles, PIP5K1A (Myc-DDK tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_003557) Human Tagged ORF Clone
RC219870L4

USD 700.00

3 Weeks

Lenti ORF clone of Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_003557) Human Tagged ORF Clone Lentiviral Particle
RC219870L4V

USD 900.00

7 Weeks

Lenti ORF particles, PIP5K1A (mGFP-tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_001135636) Human Tagged ORF Clone
RC227279L3

USD 670.00

3 Weeks

Lenti-ORF clone of PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_001135636) Human Tagged ORF Clone Lentiviral Particle
RC227279L3V

USD 870.00

6 Weeks

Lenti ORF particles, PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_001135636) Human Tagged ORF Clone
RC227279L4

USD 670.00

3 Weeks

Lenti-ORF clone of PIP5K1A (mGFP-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_001135636) Human Tagged ORF Clone Lentiviral Particle
RC227279L4V

USD 870.00

6 Weeks

Lenti ORF particles, PIP5K1A (mGFP-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_001135637) Human Tagged ORF Clone
RC227501

USD 420.00

3 Weeks

PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PIP5K1 alpha (PIP5K1A) (NM_001135637) Human Tagged ORF Clone
RC227501L3

USD 620.00

8 Weeks

Lenti-ORF clone of PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_001135637) Human Tagged ORF Clone Lentiviral Particle
RC227501L3V

USD 820.00

11 Weeks

Lenti ORF particles, PIP5K1A (Myc-DDK-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_001135637) Human Tagged ORF Clone
RC227501L4

USD 620.00

8 Weeks

Lenti-ORF clone of PIP5K1A (mGFP-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_001135637) Human Tagged ORF Clone Lentiviral Particle
RC227501L4V

USD 820.00

11 Weeks

Lenti ORF particles, PIP5K1A (mGFP-tagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_001135638) Human Tagged ORF Clone
RC227689L3

USD 720.00

3 Weeks

Lenti ORF clone of Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_001135638) Human Tagged ORF Clone Lentiviral Particle
RC227689L3V

USD 920.00

7 Weeks

Lenti ORF particles, PIP5K1A (Myc-DDK tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_001135638) Human Tagged ORF Clone
RC227689L4

USD 720.00

3 Weeks

Lenti ORF clone of Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_001135638) Human Tagged ORF Clone Lentiviral Particle
RC227689L4V

USD 920.00

7 Weeks

Lenti ORF particles, PIP5K1A (mGFP-tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_001135636) Human Tagged ORF Clone
RG227279

USD 520.00

3 Weeks

PIP5K1A (GFP-tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PIP5K1 alpha (PIP5K1A) (NM_001135637) Human Tagged ORF Clone
RG227501

USD 460.00

3 Weeks

PIP5K1A (GFP-tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PIP5K1 alpha (PIP5K1A) (NM_001135638) Human Tagged ORF Clone
RG227689

USD 570.00

3 Weeks

PIP5K1A (GFP-tagged) - Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PIP5K1 alpha (PIP5K1A) (NM_001135638) Human Tagged ORF Clone
RC227689L2

USD 720.00

In Stock

Lenti ORF clone of Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PIP5K1 alpha (PIP5K1A) (NM_003557) Human Tagged ORF Clone
RC219870L2

USD 700.00

3 Weeks

Lenti ORF clone of Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PIP5K1 alpha (PIP5K1A) Rabbit Polyclonal Antibody
TA343090

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-PIP5K1A Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pip5k1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pip5k1a. Synthetic peptide located within the following region: EGPSASVMPVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLS
PIP5K1 alpha (PIP5K1A) (NM_001135636) Human Over-expression Lysate
LC427639

USD 121.00

In Stock

PIP5K1A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PIP5K1 alpha (PIP5K1A) (NM_001135636) Human Over-expression Lysate
LY427639

USD 396.00

In Stock

Transient overexpression lysate of phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PIP5K1 alpha (PIP5K1A) (NM_003557) Human Untagged Clone
SC111072

USD 930.00

In Stock

PIP5K1A (untagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
PIP5K1 alpha (PIP5K1A) (NM_003557) Human Over-expression Lysate
LC418598

USD 187.00

2 Weeks

PIP5K1A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PIP5K1 alpha (PIP5K1A) (NM_001135638) Human Over-expression Lysate
LC427641

USD 121.00

2 Weeks

PIP5K1A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PIP5K1 alpha (PIP5K1A) (NM_003557) Human Over-expression Lysate
LY418598

USD 605.00

5 Days

Transient overexpression lysate of phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PIP5K1 alpha (PIP5K1A) (NM_001135638) Human Over-expression Lysate
LY427641

USD 396.00

5 Days

Transient overexpression lysate of phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PIP5K1 alpha (PIP5K1A) (NM_001135637) Human Untagged Clone
SC325136

USD 760.00

3 Weeks

PIP5K1A (untagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 4

Vector pCMV6 series
Tag Tag Free
PIP5K1 alpha (PIP5K1A) (NM_001135636) Human Untagged Clone
SC326023

USD 880.00

3 Weeks

PIP5K1A (untagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PIP5K1 alpha (PIP5K1A) (NM_001135638) Human Untagged Clone
SC326069

USD 950.00

3 Weeks

PIP5K1A (untagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PIP5K1 alpha (PIP5K1A) Rabbit Polyclonal Antibody
TA349607

USD 345.00

In Stock

Rabbit Polyclonal Anti-PIP5K1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PIP5K1A
PIP5K1 alpha (PIP5K1A) (NM_003557) ICC Control Block
TB419870

USD 1,150.00

4 Weeks

Transient overexpression of PIP5K1A (NM_003557) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PIP5K1 alpha (PIP5K1A) (NM_001135636) ICC Control Block
TB427279

USD 1,120.00

4 Weeks

Transient overexpression of PIP5K1A (NM_001135636) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PIP5K1 alpha (PIP5K1A) (NM_001135637) ICC Control Block
TB427501

USD 1,070.00

4 Weeks

Transient overexpression of PIP5K1A (NM_001135637) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PIP5K1 alpha (PIP5K1A) (NM_001135638) ICC Control Block
TB427689

USD 1,170.00

4 Weeks

Transient overexpression of PIP5K1A (NM_001135638) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PIP5K1 alpha (PIP5K1A) Cytosection
TS419870

USD 225.00

4 Weeks

Transient overexpression of PIP5K1A (NM_003557) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PIP5K1 alpha (PIP5K1A) Cytosection
TS419870P5

USD 889.00

4 Weeks

Transient overexpression of PIP5K1A (NM_003557) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PIP5K1 alpha (PIP5K1A) Cytosection
TS427279

USD 225.00

4 Weeks

Transient overexpression of PIP5K1A (NM_001135636) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PIP5K1 alpha (PIP5K1A) Cytosection
TS427279P5

USD 889.00

4 Weeks

Transient overexpression of PIP5K1A (NM_001135636) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack