Germany
Japan
United Kingdom
China
PLA2G4E (Myc-DDK-tagged)-Human phospholipase A2, group IVE (PLA2G4E)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PLA2G4E (GFP-tagged) - Homo sapiens phospholipase A2, group IVE (PLA2G4E)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PLA2G4E (GFP-tagged) - Human phospholipase A2, group IVE (PLA2G4E)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human phospholipase A2, group IVE (PLA2G4E), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PLA2G4E (Myc-DDK tagged) - Human phospholipase A2, group IVE (PLA2G4E), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phospholipase A2, group IVE (PLA2G4E), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PLA2G4E (mGFP-tagged) - Human phospholipase A2, group IVE (PLA2G4E), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PLA2G4E (Myc-DDK tagged) - Homo sapiens phospholipase A2, group IVE (PLA2G4E)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-PLA2G4E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G4E antibody: synthetic peptide directed towards the c terminal of human PLA2G4E. Synthetic peptide located within the following region: TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT |
PLA2G4E HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-PLA2G4E antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PLA2G4E. |
Transient overexpression lysate of phospholipase A2, group IVE (PLA2G4E)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PLA2G4E (untagged)-Human phospholipase A2, group IVE (PLA2G4E)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PLA2G4E (untagged) - Homo sapiens phospholipase A2, group IVE (PLA2G4E)
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of PLA2G4E (NM_001080490) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLA2G4E (NM_001206670) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLA2G4E (NM_001080490) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PLA2G4E (NM_001080490) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PLA2G4E (NM_001206670) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PLA2G4E
Pathways
- Fc gamma R-mediated phagocytosis