Products

View as table Download

GCH1 (Myc-DDK-tagged)-Human GTP cyclohydrolase 1 (GCH1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

GCH1 (GFP-tagged) - Human GTP cyclohydrolase 1 (GCH1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, GCH1 (Myc-DDK tagged) - Human GTP cyclohydrolase 1 (GCH1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GCH1 (mGFP-tagged) - Human GTP cyclohydrolase 1 (GCH1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GCH1 (Myc-DDK-tagged)-Human GTP cyclohydrolase 1 (GCH1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, GCH1 (Myc-DDK-tagged)-Human GTP cyclohydrolase 1 (GCH1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GCH1 (mGFP-tagged)-Human GTP cyclohydrolase 1 (GCH1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GCH1 (Myc-DDK-tagged)-Human GTP cyclohydrolase 1 (GCH1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, GCH1 (Myc-DDK-tagged)-Human GTP cyclohydrolase 1 (GCH1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GCH1 (mGFP-tagged)-Human GTP cyclohydrolase 1 (GCH1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GCH1 (Myc-DDK-tagged)-Human GTP cyclohydrolase 1 (GCH1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GCH1 (mGFP-tagged)-Human GTP cyclohydrolase 1 (GCH1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GCH1 (GFP-tagged) - Human GTP cyclohydrolase 1 (GCH1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

GCH1 (GFP-tagged) - Human GTP cyclohydrolase 1 (GCH1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

GCH1 (GFP-tagged) - Human GTP cyclohydrolase 1 (GCH1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

GCH1 (untagged)-Human GTP cyclohydrolase 1 (GCH1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Goat Anti-GCH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GKVHIGYLPNKQ, from the internal region of the protein sequence according to NP_000152.1 ; NP_001019195.1 ; NP_001019241.1 ; NP_001019242.1 .

Recombinant protein of human GTP cyclohydrolase 1 (GCH1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

Anti-GCH1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 51-64 amino acids of human GTP cyclohydrolase 1

Purified recombinant protein of Human GTP cyclohydrolase 1 (GCH1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

Lenti ORF clone of Human GTP cyclohydrolase 1 (GCH1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

GCH1 (untagged)-Human GTP cyclohydrolase 1 (GCH1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

GCH1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit Polyclonal Anti-GCH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GCH1 antibody: synthetic peptide directed towards the C terminal of human GCH1. Synthetic peptide located within the following region: LRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLT

Transient overexpression lysate of GTP cyclohydrolase 1 (GCH1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-GCH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GCH1 antibody is: synthetic peptide directed towards the N-terminal region of Human GCH1. Synthetic peptide located within the following region: PPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQR

GCH1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of GTP cyclohydrolase 1 (GCH1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB