Products

View as table Download

HK1 (Myc-DDK-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

HK1 (Myc-DDK-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

HK1 (GFP-tagged) - Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, HK1 (Myc-DDK tagged) - Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, HK1 (mGFP-tagged) - Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, HK1 (mGFP-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

HK1 (Myc-DDK-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

HK1 (Myc-DDK-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HK1 (Myc-DDK tagged) - Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HK1 (mGFP-tagged) - Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

HK1 (Myc-DDK-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of HK1 (Myc-DDK-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HK1 (Myc-DDK-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of HK1 (mGFP-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HK1 (mGFP-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of HK1 (Myc-DDK-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HK1 (Myc-DDK-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of HK1 (mGFP-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HK1 (mGFP-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of HK1 (Myc-DDK-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HK1 (Myc-DDK-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of HK1 (mGFP-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HK1 (mGFP-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of HK1 (Myc-DDK-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HK1 (Myc-DDK-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of HK1 (mGFP-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HK1 (mGFP-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

HK1 (GFP-tagged) - Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HK1 (GFP-tagged) - Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HK1 (GFP-tagged) - Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HK1 (GFP-tagged) - Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HK1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HK1

HK1 (untagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal anti-HK1 (HXK1) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HXK1.

Hexokinase-1 (1-917, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

Hexokinase-1 (1-917, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Rabbit Polyclonal Anti-Hexokinase 1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Hexokinase 1 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human Hexokinase 1.

Lenti ORF clone of Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti-ORF clone of HK1 (mGFP-tagged)-Human hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 4

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

HK1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

HK1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of hexokinase 1 (HK1), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-HK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HK1 antibody: synthetic peptide directed towards the middle region of human HK1. Synthetic peptide located within the following region: ILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR

Rabbit Polyclonal Anti-HK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HK1 antibody: synthetic peptide directed towards the N terminal of human HK1. Synthetic peptide located within the following region: CQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVV

Mouse Monoclonal Hexokinase 1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated