Germany
Japan
United Kingdom
China
CEL (Myc-DDK tagged) - Homo sapiens carboxyl ester lipase (CEL)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadCEL (GFP-tagged) - Homo sapiens carboxyl ester lipase (CEL)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CEL (untagged)-Human carboxyl ester lipase (bile salt-stimulated lipase), mRNA (cDNA clone MGC:35409 IMAGE:5187959), complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Bile salt activated lipase (CEL) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 453-482 amino acids from the Central region of human CEL |
Rabbit Polyclonal Anti-CEL Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-CEL antibody: synthetic peptide directed towards the middle region of human CEL. Synthetic peptide located within the following region: VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR |
Transient overexpression of CEL (NM_001807) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CEL (NM_001807) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CEL
Pathways
- Glycerolipid metabolism