Products

cDNA Clones (11)
Antibodies (6)
Proteins (4)
Jump to Filters
View as table Download
LIPC (NM_000236) Human Tagged ORF Clone
RC215870

USD 420.00

In Stock

LIPC (Myc-DDK-tagged)-Human lipase, hepatic (LIPC)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LIPC (NM_000236) Human Tagged ORF Clone
RG215870

USD 460.00

In Stock

LIPC (GFP-tagged) - Human lipase, hepatic (LIPC)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LIPC (NM_000236) Human Tagged ORF Clone
RC215870L3

USD 620.00

3 Weeks

Lenti ORF clone of Human lipase, hepatic (LIPC), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LIPC (NM_000236) Human Tagged ORF Clone
RC215870L4

USD 620.00

3 Weeks

Lenti ORF clone of Human lipase, hepatic (LIPC), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LIPC (NM_000236) Human Untagged Clone
SC120025

USD 760.00

In Stock

LIPC (untagged)-Human lipase, hepatic (LIPC)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
LIPC (NM_000236) Human Tagged ORF Clone
RC215870L1

USD 768.00

In Stock

Lenti ORF clone of Human lipase, hepatic (LIPC), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
LIPC Rabbit Polyclonal Antibody
TA327045

USD 380.00

In Stock

Rabbit anti-LIPC Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human LIPC
LIPC (Center) Rabbit Polyclonal Antibody
AP52492PU-N

USD 450.00

2 Weeks

LIPC (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 310-338 amino acids from the Central region of Human LIPC / Hepatic lipase
LIPC (NM_000236) Human Tagged ORF Clone
RC215870L2

USD 620.00

3 Weeks

Lenti ORF clone of Human lipase, hepatic (LIPC), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
LIPC (N-term) Rabbit Polyclonal Antibody
AP52493PU-N

USD 450.00

2 Weeks

LIPC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 16-44 amino acids from the N-terminal region of Human LIPC / Hepatic lipase
LIPC Rabbit Polyclonal Antibody
TA321090

USD 345.00

4 Weeks

Anti-LIPC Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 220 amino acids of human lipase, hepatic
LIPC Rabbit Polyclonal Antibody
TA343317

USD 375.00

5 Days

Rabbit Polyclonal Anti-LIPC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIPC antibody is: synthetic peptide directed towards the C-terminal region of LIPC. Synthetic peptide located within the following region: LKTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIKSKTSKRKIR
LIPC (NM_000236) Human Mass Spec Standard
PH315870

USD 2,055.00

3 Weeks

LIPC MS Standard C13 and N15-labeled recombinant protein (NP_000227)

Tag C-Myc/DDK
Expression Host HEK293
LIPC Rabbit Polyclonal Antibody
TA358434

USD 360.00

5 Days

LIPC Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
LIPC (NM_000236) ICC Control Block
TB415870

USD 1,070.00

4 Weeks

Transient overexpression of LIPC (NM_000236) in HEK293T cells paraffin embedded controls for ICC/IHC staining

LIPC Cytosection
TS415870

USD 225.00

4 Weeks

Transient overexpression of LIPC (NM_000236) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

LIPC Cytosection
TS415870P5

USD 889.00

4 Weeks

Transient overexpression of LIPC (NM_000236) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack