CDS2 (Myc-DDK-tagged)-Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDS2 (Myc-DDK-tagged)-Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CDS2 (Myc-DDK tagged) - Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDS2 (mGFP-tagged) - Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CDS2 (GFP-tagged) - Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
CDS2 (untagged)-Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CDS2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CDS2 (untagged)-Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CDS2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CDS2 antibody is: synthetic peptide directed towards the C-terminal region of Human CDS2. Synthetic peptide located within the following region: EYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIA |
Transient overexpression lysate of CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of CDS2 (NM_003818) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDS2 (NM_003818) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDS2 (NM_003818) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack