Products

cDNA Clones (8)
Proteins (5)
Antibodies (1)
Jump to Filters
View as table Download
CDS2 (NM_003818) Human Tagged ORF Clone
RC206807

USD 420.00

In Stock

CDS2 (Myc-DDK-tagged)-Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CDS2 (NM_003818) Human Tagged ORF Clone Lentiviral Particle
RC206807L3V

USD 820.00

3 Weeks

Lenti ORF particles, CDS2 (Myc-DDK tagged) - Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDS2 (NM_003818) Human Tagged ORF Clone
RC206807L4

USD 620.00

3 Weeks

Lenti ORF clone of Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDS2 (NM_003818) Human Tagged ORF Clone Lentiviral Particle
RC206807L4V

USD 820.00

7 Weeks

Lenti ORF particles, CDS2 (mGFP-tagged) - Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDS2 (NM_003818) Human Tagged ORF Clone
RG206807

USD 460.00

3 Weeks

CDS2 (GFP-tagged) - Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDS2 (NM_003818) Human Tagged Lenti ORF Clone
RC206807L3

USD 768.00

In Stock

Lenti ORF clone of Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDS2 (NM_003818) Human Untagged Clone
SC120671

USD 310.00

In Stock

CDS2 (untagged)-Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CDS2 (NM_003818) Human Over-expression Lysate
LC418419

USD 121.00

In Stock

CDS2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDS2 (NM_003818) Human Untagged Clone
SC324271

USD 310.00

In Stock

CDS2 (untagged)-Human CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
CDS2 Rabbit Polyclonal Antibody
TA339380

USD 375.00

5 Days

Rabbit Polyclonal Anti-CDS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CDS2 antibody is: synthetic peptide directed towards the C-terminal region of Human CDS2. Synthetic peptide located within the following region: EYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIA
CDS2 (NM_003818) Human Over-expression Lysate
LY418419

USD 396.00

5 Days

Transient overexpression lysate of CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (CDS2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDS2 (NM_003818) ICC Control Block
TB406807

USD 1,070.00

4 Weeks

Transient overexpression of CDS2 (NM_003818) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CDS2 Cytosection
TS406807

USD 225.00

4 Weeks

Transient overexpression of CDS2 (NM_003818) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CDS2 Cytosection
TS406807P5

USD 889.00

4 Weeks

Transient overexpression of CDS2 (NM_003818) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack