Products

cDNA Clones (6)
Proteins (5)
Antibodies (2)
Jump to Filters
View as table Download
DAGK (DGKQ) (NM_001347) Human Tagged ORF Clone
RC209068

USD 420.00

In Stock

DGKQ (Myc-DDK-tagged)-Human diacylglycerol kinase, theta 110kDa (DGKQ)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
DAGK (DGKQ) (NM_001347) Human Tagged ORF Clone
RC209068L3

USD 620.00

3 Weeks

Lenti ORF clone of Human diacylglycerol kinase, theta 110kDa (DGKQ), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DAGK (DGKQ) (NM_001347) Human Tagged ORF Clone
RG209068

USD 460.00

3 Weeks

DGKQ (GFP-tagged) - Human diacylglycerol kinase, theta 110kDa (DGKQ)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DAGK (DGKQ) (NM_001347) Human Untagged Clone
SC119320

USD 310.00

In Stock

DGKQ (untagged)-Human diacylglycerol kinase, theta 110kDa (DGKQ)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
DAGK (DGKQ) Rabbit Polyclonal Antibody
TA313743

USD 345.00

In Stock

Rabbit polyclonal anti-DGKQ antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKQ.
DAGK (DGKQ) (NM_001347) Human Over-expression Lysate
LC419993

USD 121.00

In Stock

DGKQ HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DAGK (DGKQ) Rabbit Polyclonal Antibody
TA340014

USD 375.00

5 Days

Rabbit Polyclonal Anti-DGKQ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKQ antibody: synthetic peptide directed towards the middle region of human DGKQ. Synthetic peptide located within the following region: DAELSLDFHQAREEEPGKFTSRLHNKGVYVRVGLQKISHSRSLHKQIRLQ
DAGK (DGKQ) ICC Control Block
TB409068

USD 1,070.00

4 Weeks

Transient overexpression of DGKQ (NM_001347) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DAGK (DGKQ) Cytosection
TS409068

USD 225.00

4 Weeks

Transient overexpression of DGKQ (NM_001347) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

DAGK (DGKQ) Cytosection
TS409068P5

USD 889.00

4 Weeks

Transient overexpression of DGKQ (NM_001347) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack