Products

cDNA Clones (10)
Antibodies (5)
Proteins (5)
Jump to Filters
View as table Download
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone
RC205320

USD 480.00

In Stock

MAOB (Myc-DDK-tagged)-Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone
RG205320

USD 530.00

In Stock

MAOB (GFP-tagged) - Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone
RC205320L3

USD 680.00

3 Weeks

Lenti ORF clone of Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone Lentiviral Particle
RC205320L3V

USD 880.00

7 Weeks

Lenti ORF particles, MAOB (Myc-DDK tagged) - Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone
RC205320L4

USD 680.00

3 Weeks

Lenti ORF clone of Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone Lentiviral Particle
RC205320L4V

USD 880.00

5 Weeks

Lenti ORF particles, MAOB (mGFP-tagged) - Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Over-expression Lysate
LY400321

USD 396.00

In Stock

Transient overexpression lysate of monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Monoamine Oxidase B (MAOB) Rabbit Polyclonal Antibody
TA327079

USD 275.00

2 Weeks

Rabbit anti-MAOB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAOB
Monoamine Oxidase B (MAOB) (NM_000898) Human Untagged Clone
SC108847

USD 310.00

In Stock

MAOB (untagged)-Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Monoamine Oxidase B (MAOB) Goat Polyclonal Antibody
TA318153

USD 425.00

In Stock

Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit
Conjugation Unconjugated
Immunogen MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%).
Monoamine Oxidase B (MAOB) (NM_000898) Human Tagged ORF Clone
RC205320L1

USD 680.00

3 Weeks

Lenti ORF clone of Human monoamine oxidase B (MAOB), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Monoamine Oxidase B (MAOB) (NM_000898) Human Over-expression Lysate
LC400321

USD 121.00

In Stock

MAOB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Monoamine Oxidase B (MAOB) Rabbit Polyclonal Antibody
TA332354

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAOB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV
Monoamine Oxidase B (MAOB) Rabbit Polyclonal Antibody
TA332355

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the C terminal of human MAOB. Synthetic peptide located within the following region: GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA
Monoamine Oxidase B (MAOB) Goat Polyclonal Antibody
TA302534

USD 375.00

5 Days

Goat Polyclonal Antibody against MAOB

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3.
Monoamine Oxidase B (MAOB) ICC Control Block
TB405320

USD 1,130.00

4 Weeks

Transient overexpression of MAOB (NM_000898) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Monoamine Oxidase B (MAOB) Cytosection
TS405320

USD 225.00

4 Weeks

Transient overexpression of MAOB (NM_000898) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Monoamine Oxidase B (MAOB) Cytosection
TS405320P5

USD 889.00

4 Weeks

Transient overexpression of MAOB (NM_000898) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack