Products

cDNA Clones (7)
Proteins (5)
Antibodies (1)
Jump to Filters
View as table Download
PLA2G2C (NM_001105572) Human Tagged ORF Clone
RC225128

USD 420.00

In Stock

PLA2G2C (Myc-DDK-tagged)-Human phospholipase A2, group IIC (PLA2G2C)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PLA2G2C (NM_001105572) Human Tagged ORF Clone
RC225128L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phospholipase A2, group IIC (PLA2G2C), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PLA2G2C (NM_001105572) Human Tagged ORF Clone
RC225128L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phospholipase A2, group IIC (PLA2G2C), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PLA2G2C (NM_001105572) Human Tagged ORF Clone
RG225128

USD 460.00

3 Weeks

PLA2G2C (GFP-tagged) - Human phospholipase A2, group IIC (PLA2G2C)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PLA2G2C Rabbit Polyclonal Antibody
TA334348

USD 375.00

5 Days

Rabbit Polyclonal Anti-PLA2G2C Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-PLA2G2C antibody is: synthetic peptide directed towards the middle region of Human PLA2G2C. Synthetic peptide located within the following region: LGDKGIPVDDTDSPSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTL
PLA2G2C (NM_001105572) Human Over-expression Lysate
LC426282

USD 121.00

2 Weeks

PLA2G2C HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PLA2G2C (NM_001105572) Human Over-expression Lysate
LY426282

USD 396.00

5 Days

Transient overexpression lysate of phospholipase A2, group IIC (PLA2G2C)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PLA2G2C (NM_001105572) Human Untagged Clone
SC317032

USD 420.00

3 Weeks

PLA2G2C (untagged)-Human phospholipase A2, group IIC (PLA2G2C)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PLA2G2C (NM_001105572) ICC Control Block
TB425128

USD 1,070.00

4 Weeks

Transient overexpression of PLA2G2C (NM_001105572) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PLA2G2C Cytosection
TS425128

USD 225.00

4 Weeks

Transient overexpression of PLA2G2C (NM_001105572) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PLA2G2C ICC Control Sections
TS425128P5

USD 889.00

4 Weeks

Transient overexpression of PLA2G2C (NM_001105572) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack