Products

View as table Download

Goat Anti-NDUFS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DTRPTVRPRNDVAHK, from the internal region of the protein sequence according to NP_004542.1.

Rabbit polyclonal Anti-NDUFS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDUFS3 antibody: synthetic peptide directed towards the middle region of human NDUFS3. Synthetic peptide located within the following region: ANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQ

Rabbit polyclonal Anti-NDUFS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDUFS3 antibody: synthetic peptide directed towards the middle region of human NDUFS3. Synthetic peptide located within the following region: EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

Rabbit Polyclonal Anti-NDUFS3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFS3