Germany
Japan
United Kingdom
China
TRIP10 (Myc-DDK-tagged)-Human thyroid hormone receptor interactor 10 (TRIP10)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human thyroid hormone receptor interactor 10 (TRIP10)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human thyroid hormone receptor interactor 10 (TRIP10), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TRIP10 (Myc-DDK tagged) - Human thyroid hormone receptor interactor 10 (TRIP10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human thyroid hormone receptor interactor 10 (TRIP10), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TRIP10 (mGFP-tagged) - Human thyroid hormone receptor interactor 10 (TRIP10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TRIP10 (myc-DDK-tagged) - Human thyroid hormone receptor interactor 10 (TRIP10), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TRIP10 (myc-DDK-tagged) - Human thyroid hormone receptor interactor 10 (TRIP10), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TRIP10 (GFP-tagged) - Human thyroid hormone receptor interactor 10 (TRIP10)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TRIP10 (untagged)-Human thyroid hormone receptor interactor 10 (TRIP10)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
TRIP10 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-TRIP10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIP10 Antibody: synthetic peptide directed towards the N terminal of human TRIP10. Synthetic peptide located within the following region: QEMKQERKMHFQEGRRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAE |
Rabbit Polyclonal Anti-TRIP10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIP10 Antibody: synthetic peptide directed towards the N terminal of human TRIP10. Synthetic peptide located within the following region: ENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSHMAE |
Rabbit Polyclonal Anti-TRIP10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIP10 antibody: synthetic peptide directed towards the middle region of human TRIP10. Synthetic peptide located within the following region: FEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTL |
TRIP10 (260-545, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
TRIP10 (260-545, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of thyroid hormone receptor interactor 10 (TRIP10)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
TRIP10 MS Standard C13 and N15-labeled recombinant protein (NP_004231)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
TRIP10 (GFP-tagged) - Human thyroid hormone receptor interactor 10 (TRIP10), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TRIP10 (GFP-tagged) - Human thyroid hormone receptor interactor 10 (TRIP10), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TRIP10 (untagged) - Human thyroid hormone receptor interactor 10 (TRIP10), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TRIP10 (untagged) - Human thyroid hormone receptor interactor 10 (TRIP10), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of TRIP10 (NM_004240) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TRIP10 (NM_001288963) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TRIP10 (NM_001288962) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TRIP10 (NM_004240) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TRIP10 (NM_004240) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TRIP10 (NM_001288963) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TRIP10 (NM_001288962) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TRIP10
Pathways
- Insulin signaling pathway