Products

cDNA Clones (21)
Antibodies (13)
Proteins (10)
Jump to Filters
View as table Download
Claudin 5 (CLDN5) (NM_003277) Human Tagged ORF Clone
RC207122

USD 420.00

In Stock

CLDN5 (Myc-DDK-tagged)-Human claudin 5 (CLDN5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Claudin 5 (CLDN5) (NM_001130861) Human Tagged ORF Clone
RC225423

USD 420.00

In Stock

CLDN5 (Myc-DDK-tagged)-Human claudin 5 (CLDN5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Claudin 5 (CLDN5) (NM_003277) Human Tagged ORF Clone
RG207122

USD 460.00

In Stock

CLDN5 (GFP-tagged) - Human claudin 5 (CLDN5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 5 (CLDN5) (NM_001130861) Human Tagged ORF Clone
RG225423

USD 460.00

In Stock

CLDN5 (GFP-tagged) - Human claudin 5 (CLDN5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 5 (CLDN5) (NM_003277) Human Tagged ORF Clone
RC207122L4

USD 620.00

In Stock

Lenti ORF clone of Human claudin 5 (CLDN5), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Claudin 5 (CLDN5) (NM_003277) Human Tagged ORF Clone
RC207122L3

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 5 (CLDN5), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Claudin 5 (CLDN5) (NM_001130861) Human Untagged Clone
SC325743

USD 660.00

In Stock

CLDN5 (untagged)-Human claudin 5 (CLDN5), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA347354

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Claudin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5
Claudin 5 (CLDN5) (NM_003277) Human Over-expression Lysate
LC401129

USD 121.00

In Stock

CLDN5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA312091

USD 345.00

4 Weeks

Rabbit polyclonal anti-Claudin 5 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CLDN5.
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA347919

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Claudin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig, Cow
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5
Claudin 5 (CLDN5) (NM_003277) Human Over-expression Lysate
LY401129

USD 396.00

5 Days

Transient overexpression lysate of claudin 5 (CLDN5), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 5 (CLDN5) (NM_003277) Human Tagged ORF Clone
RC207122L2

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 5 (CLDN5), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Claudin 5 (CLDN5) (NM_001130861) Human Tagged ORF Clone
RC225423L2

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 5 (CLDN5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Claudin 5 (CLDN5) (NM_003277) Human Untagged Clone
SC118095

USD 660.00

In Stock

CLDN5 (untagged)-Human claudin 5 (CLDN5), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA312090

USD 345.00

In Stock

Rabbit polyclonal Claudin 5 (Tyr217) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Claudin 5 around the phosphorylation site of tyrosine 217 (K-N-YP-V).
Modifications Phospho-specific
Claudin 5 (CLDN5) (NM_001130861) Human Over-expression Lysate
LC427293

USD 121.00

In Stock

CLDN5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 5 (CLDN5) (NM_001130861) Human Over-expression Lysate
LY427293

USD 396.00

2 Weeks

Transient overexpression lysate of claudin 5 (CLDN5), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA334202

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLDN5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN5 antibody: synthetic peptide directed towards the C terminal of human CLDN5. Synthetic peptide located within the following region: GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA354288

USD 355.00

5 Days

Rabbit anti Claudin 5 Polyclonal Antibody

Reactivities Human, Mouse
Conjugation Unconjugated
Claudin 5 (CLDN5) Mouse Monoclonal Antibody [Clone ID: OTI1G4]
CF500843

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CLDN5 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications FC, IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Claudin 5 (CLDN5) (NM_003277) Human Untagged Clone
SC327783

USD 660.00

3 Weeks

CLDN5 (untagged)-Human claudin 5 (CLDN5) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA323846

USD 345.00

In Stock

Anti-CLDN5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 202-215 amino acids of Human claudin 5
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA323847

USD 345.00

In Stock

Anti-CLDN5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 202-215 amino acids of Human claudin 5
Claudin 5 (CLDN5) Mouse Monoclonal Antibody [Clone ID: OTI1G4]
TA500843

USD 379.00

In Stock

CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications FC, IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Claudin 5 (CLDN5) Mouse Monoclonal Antibody [Clone ID: OTI1G4]
TA500843S

USD 159.00

In Stock

CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications FC, IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Claudin 5 (CLDN5) ICC Control Block
TB407122

USD 1,070.00

4 Weeks

Transient overexpression of CLDN5 (NM_003277) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Claudin 5 (CLDN5) ICC Control Block
TB425423

USD 1,070.00

4 Weeks

Transient overexpression of CLDN5 (NM_001130861) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Claudin 5 (CLDN5) Cytosection
TS407122

USD 225.00

4 Weeks

Transient overexpression of CLDN5 (NM_003277) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Claudin 5 (CLDN5) Cytosection
TS407122P5

USD 889.00

4 Weeks

Transient overexpression of CLDN5 (NM_003277) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Claudin 5 (CLDN5) Cytosection
TS425423

USD 225.00

4 Weeks

Transient overexpression of CLDN5 (NM_001130861) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Claudin 5 (CLDN5) Cytosection
TS425423P5

USD 889.00

4 Weeks

Transient overexpression of CLDN5 (NM_001130861) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack