CLDN5 (Myc-DDK-tagged)-Human claudin 5 (CLDN5), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CLDN5 (Myc-DDK-tagged)-Human claudin 5 (CLDN5), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,020.00
3 Weeks
Lenti ORF particles, CLDN5 (mGFP-tagged) - Human claudin 5 (CLDN5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CLDN5 (Myc-DDK-tagged)-Human claudin 5 (CLDN5), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
2 Weeks
Lenti ORF particles, CLDN5 (Myc-DDK tagged) - Human claudin 5 (CLDN5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
CLDN5 (GFP-tagged) - Human claudin 5 (CLDN5), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CLDN5 (GFP-tagged) - Human claudin 5 (CLDN5), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
6 Weeks
Lenti ORF particles, CLDN5 (mGFP-tagged) - Human claudin 5 (CLDN5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
3 Weeks
Lenti ORF particles, CLDN5 (Myc-DDK tagged) - Human claudin 5 (CLDN5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, CLDN5 (mGFP-tagged) - Human claudin 5 (CLDN5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human claudin 5 (CLDN5), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, CLDN5 (mGFP-tagged) - Human claudin 5 (CLDN5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human claudin 5 (CLDN5), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, CLDN5 (Myc-DDK tagged) - Human claudin 5 (CLDN5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human claudin 5 (CLDN5), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, CLDN5 (Myc-DDK tagged) - Human claudin 5 (CLDN5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
CLDN5 (untagged)-Human claudin 5 (CLDN5), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human claudin 5 (CLDN5), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-Claudin 5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5 |
CLDN5 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit polyclonal anti-Claudin 5 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human CLDN5. |
Rabbit Polyclonal Anti-Claudin 5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig, Cow |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5 |
Transient overexpression lysate of claudin 5 (CLDN5), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human claudin 5 (CLDN5), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human claudin 5 (CLDN5), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CLDN5 (untagged)-Human claudin 5 (CLDN5), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal Claudin 5 (Tyr217) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Claudin 5 around the phosphorylation site of tyrosine 217 (K-N-YP-V). |
Modifications | Phospho-specific |
CLDN5 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of claudin 5 (CLDN5), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-CLDN5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLDN5 antibody: synthetic peptide directed towards the C terminal of human CLDN5. Synthetic peptide located within the following region: GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN |
Rabbit anti Claudin 5 Polyclonal Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CLDN5 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
Applications | FC, IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CLDN5 (untagged)-Human claudin 5 (CLDN5) transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Anti-CLDN5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 202-215 amino acids of Human claudin 5 |
Anti-CLDN5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 202-215 amino acids of Human claudin 5 |
CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
Applications | FC, IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4), Biotinylated
Applications | FC, IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4), HRP conjugated
Applications | FC, IF |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
Applications | FC, IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of CLDN5 (NM_003277) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CLDN5 (NM_001130861) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CLDN5 (NM_003277) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CLDN5 (NM_003277) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CLDN5 (NM_001130861) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CLDN5 (NM_001130861) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack