Germany
Japan
United Kingdom
China
SUV39H2 (Myc-DDK-tagged)-Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, SUV39H2 (Myc-DDK tagged) - Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SUV39H2 (mGFP-tagged) - Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, SUV39H2 (Myc-DDK tagged) - Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SUV39H2 (mGFP-tagged) - Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
SUV39H2 (Myc-DDK-tagged)-Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SUV39H2 (GFP-tagged) - Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SUV39H2 (GFP-tagged) - Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SUV39H2 (Myc-DDK tagged) - Homo sapiens suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SUV39H2 (Myc-DDK tagged) - Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, SUV39H2 (mGFP-tagged) - Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SUV39H2 (Myc-DDK-tagged)-Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of SUV39H2 (Myc-DDK-tagged)-Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 5
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SUV39H2 (Myc-DDK-tagged)-Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of SUV39H2 (mGFP-tagged)-Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 5
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SUV39H2 (mGFP-tagged)-Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SUV39H2 (Myc-DDK-tagged)-Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of SUV39H2 (Myc-DDK-tagged)-Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 4
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SUV39H2 (Myc-DDK-tagged)-Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of SUV39H2 (mGFP-tagged)-Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 4
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SUV39H2 (mGFP-tagged)-Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SUV39H2 (Myc-DDK tagged) - Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SUV39H2 (mGFP-tagged) - Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SUV39H2 (GFP-tagged) - Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SUV39H2 (GFP-tagged) - Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SUV39H2 (GFP-tagged) - Homo sapiens suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
SUV39H2 (untagged)-Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit anti-SUV39H2 Polyclonal Antibody
| Applications | ChIP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SUV39H2 |
Rabbit Polyclonal Anti-SUV39H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUV39H2 antibody: synthetic peptide directed towards the middle region of human SUV39H2. Synthetic peptide located within the following region: LDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRT |
Lenti ORF clone of Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-SUV39H2 antibody
| Applications | WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SUV39H2. |
Transient overexpression lysate of suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
SUV39H2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
SUV39H2 (untagged) - Homo sapiens suppressor of variegation 3-9 homolog 2 (Drosophila) (SUV39H2), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of SUV39H2 (NM_024670) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SUV39H2 (NM_001193427) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SUV39H2 (NM_001193426) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SUV39H2 (NM_001193424) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SUV39H2 (NM_001193425) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SUV39H2 (NM_024670) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SUV39H2 (NM_024670) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SUV39H2 (NM_001193427) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SUV39H2 (NM_001193426) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SUV39H2
Pathways
- Lysine degradation