Germany
Japan
United Kingdom
China
ATP6V0D1 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ATP6V0D1 (Myc-DDK tagged) - Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ATP6V0D1 (mGFP-tagged) - Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ATP6V0D1 (GFP-tagged) - Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATP6V0D1 (untagged)-Human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ATP6V0D1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATP6V0D1 antibody is: synthetic peptide directed towards the C-terminal region of Human ATP6V0D1. Synthetic peptide located within the following region: KLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQ |
Rabbit Polyclonal Anti-ATP6V0D1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATP6V0D1 antibody is: synthetic peptide directed towards the C-terminal region of Human ATP6V0D1. Synthetic peptide located within the following region: GGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPE |
ATP6V0D1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ATP6V0D1 MS Standard C13 and N15-labeled recombinant protein (NP_004682)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of ATP6V0D1 (NM_004691) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATP6V0D1 (NM_004691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ATP6V0D1 (NM_004691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ATP6V0D1
Pathways
- Lysosome